KEGG   Fusarium graminearum: FG05114.1Help
Entry
FG05114.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
fgr  Fusarium graminearum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FG05114.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     FG05114.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 320 aa AA seqDB search
MTSHASAPQITVLGSLNMDLVSYVPHHPLPGETLTSSHFNTSPGGKGANQAVACGKLSRD
SDLANPSANVSMVGAVGADPYGTLLLDSLRSFGVSVDSVTARQDQKSGIAIIIVDEPSGQ
NRIIVSPEANHSLRPADFETLPGLRPDLLIMQLEIPFDTVMQALKVAKRDGVPVLLNPAP
AQTLPMDAYDGLAHLVVNETEAAILAECNESELDTPAGLERVGRVFIDRGVHNVIITLGG
RGVYFVNKQGQSALLPATKTTVVDTTAAGDTFVGSYSLAAVAARGGQFDIEAAVTAANRA
AALTVARKGAQISIPWKDEL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccacgctagcgctccgcagattacggtcctgggttctctcaatatggatctt
gtctcctacgtcccacaccatcccctacccggtgaaacactcacttcatcccatttcaac
acttcgcccggcggcaagggtgccaaccaggctgtagcatgcggcaaactgtctcgggat
tctgacctggccaacccgtcggccaacgtctccatggtgggtgccgttggcgctgatcca
tatggcaccctcctgcttgatagtcttcgctcttttggcgtttccgttgactctgttact
gctcgtcaggaccaaaagtctggaattgccatcattattgttgatgagccctcgggccag
aaccgtattattgtatctcctgaggccaaccactcgcttcggcccgccgatttcgagact
cttccaggccttcgccctgacctccttatcatgcagctcgaaatccctttcgatactgtc
atgcaggccttgaaggttgctaagagggatggggttcccgtgcttctcaatccagctccc
gctcagaccctacccatggatgcttatgacgggctcgcccaccttgttgtcaacgagact
gaagcggcgatccttgcagagtgtaatgaatctgaacttgacactcctgctggcttggaa
cgtgttggtcgagttttcattgatcgtggagtccacaatgtcatcatcactctgggaggt
cgcggcgtctacttcgtcaacaagcaaggccagagtgcattacttcctgctacaaagaca
accgtagtggacaccacagccgccggagacacctttgttggttcttactctttggccgct
gtcgccgctaggggcggccagtttgacatcgaagccgctgtcaccgcggctaatcgggca
gctgccttgactgttgcgcgcaagggcgctcaaatctctattccatggaaggatgaacta
tag

DBGET integrated database retrieval system