KEGG   Fusarium graminearum: FG05297.1Help
Entry
FG05297.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
fgr  Fusarium graminearum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    FG05297.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     FG05297.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1519 aa AA seqDB search
MASDPSNAAQMAGDVAETVAHALSFSSSPPSAMSTMPAVTVHEPYTWFGLFGWLILSILH
ITSTILYWVIRIATINVPSFLFHLFSTSWTVTMNATTLMFIMAAVVSAVSWVVRYRILNM
YSRLPPEPQRKEPEIDLFPDTHEGGSKSGLANYLDEFLSAIKIFGYLERPVFHELTRSMQ
TRKLIAGETINLEEEKGFCIVVDGLVEIFVKSNRSPRAAAASRGHLDLDSSDEDDDAPGQ
QTYQLLTEVRNGAPMSSLFSIMSLFTEDVGLRPNEENEEPPLHPAKSSGLRHPTFEKQNL
SMPGTPHNHHKFEADEKKPEGLGVSGMETEHTAIPPISLDGSTPPPRPTRPPMPSRATSG
SAHPDIIARATVDTTIAIIPASAFRRLIKIYPKATAHIVHVILSRFQRVTLAQAFNYLGL
TSEVLQTEKSMIKYTMCQLPNILRGDALERLKEKFKRERERSEEEDDTKGIALHNSASTH
RRRSSTGLRKEAMLQSMTKLRGASVVTSTITPPRERASPHTPSPGDLLSNTQLPGRGASR
VSQADQRAVSGASMRRQGANPKDDRFFNDPFDSRRLGRMTLDPRETVDEDNLFRASILEC
MFKSLGLDTNGSVSREPESMEGSPKLVSVDHRRSRFGNQSNAFGFMPPYDGSVDGDTESV
TSNGTALHAPVSAHNLANDMKDEVEIVFFPKGSVLVEQGERNPGLYYVVDGFLDIGTSSE
GDAHNILKSSGFGKSQQDPSSPDPSDMGSFPTLAKTETARDQAEAETQQSASKKSRRSIA
LVKPGGLAGYIGSVSSYRSFIDVVAKTDVYVGFLPRASLERIVDRYPIVLLTMAKRLTNI
LPRLILHIDFALEWVQVNAGQVLFHEADESEAIYIVLNGRLRMVQERKGGSGGVTALAEY
GQGDSVGELEVLTETARPGTLHAIRDTELVKFPRTLFNSLAQEHPNITIKISKIIASRMR
AIVDDTSKFSSKDASTSPKTLMRKSNMNLRTVAILPVTAGVPVVEFGNRLMNALAQVGPA
NGATSLNQAAILNHLGKHAFNKMGKLRLSQYLADLEEKYGLVVYVADTNVNSPWTQTCIT
QADSILLVGLAEGSPAIGEYERFMLGTKSTARKVLVLLHAERYSRPGLTRAWLQNRMWIN
GGHCHIQMAFRTNQMPVHAPKKLGQALKERVQVLQAEIQKYTSRKVHHTPYYSPDSPFKG
DFHRLARRLCGKSIGLVLGGGGARGITQIGIIRAMEEAGIPIDLVGGTSIGAFVGALYAR
HADVVPMFGFAKKFAGRMASLWRFALDLTYPSASYTTGHEFNRGIFKALGDTQMEDFWLE
YYCNTTNISKSRAEFHTSGYAWRYIRASMSLAGLLPPLCDEGSMLLDGGYIDNLTVSHMK
GLGVDIIFAIDVGALDDDTPQTYGDSLSGAWAFVNRWNPFSPHPNPPTLAEIQGRLAYVS
SVDALERAKTMAGCIYMRPPIDDYGTLDFHKFDELYQLGYKYGQEFFNKMKEQGVLPLVE
ETEAKKALRRTMAPRRASI
NT seq 4560 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgatccgtcaaacgccgctcaaatggccggcgacgtcgctgagactgtcgcc
catgccctcagcttcagcagctcccctccctccgcgatgagcacaatgcctgccgtcacc
gttcatgagccttacacatggtttggcctctttgggtggctgattctatctatattgcac
attacatcgactatcctttattgggtgatccggattgcgactatcaatgtcccttccttc
ttattccacttgttctccacaagctggaccgttaccatgaatgctaccacgctcatgttc
atcatggcagccgtcgtgtcggccgtcagttgggttgtgagatatcgcatcctcaacatg
tactctcgtctgcctccagagccccagcgcaaagagccggagatcgaccttttcccggat
actcacgagggtggttccaagtcgggtttggcaaactatctggacgagttcttaagtgcc
atcaagatctttggctacctagagcggcctgtctttcacgagttgactcgaagcatgcaa
acgcggaagctcattgctggggagaccatcaacctcgaagaagaaaagggtttctgtatt
gtcgtcgatggattggttgagatttttgtcaaatcaaaccgaagcccacgcgctgccgct
gcctctcgaggacaccttgatctggactcgtccgatgaagatgacgacgctcctggtcag
cagacttatcaactcttgacagaagttcgcaacggagcccccatgtcgtcactgttttct
atcatgtctctttttacagaggatgttgggctgcggccaaacgaagagaacgaggagcct
cctttgcaccccgccaaaagcagtggtcttcgccatccgacttttgagaagcagaacctg
tctatgcctggcacgcctcacaatcatcataaatttgaggcagatgagaagaagccggaa
ggtctgggtgtttctggtatggaaactgaacacactgccattccgcctatctcactggat
ggctccactccccctcctcggcccactaggccgcctatgccatcaagagcaacatccggc
tcagcgcatccagacattattgctcgtgccacggttgataccacgattgccattattcct
gcgagtgctttcaggaggcttatcaagatctacccaaaggctaccgcacacatcgtccac
gtcattctctccagattccagagagtcactcttgcgcaggccttcaactatctgggcttg
accagtgaggtactgcagacggagaagagcatgattaagtataccatgtgtcagctcccc
aacatattacgaggtgatgccctggagcgcctcaaggagaagttcaaacgggaacgtgaa
cgcagtgaggaggaagatgacacgaagggtattgcactacacaactcggcatctactcac
cggcgacggtctagcaccggactgcggaaggaggccatgttacagtcaatgacaaaactg
agaggggcttcagttgtcacaagcacgatcacaccgcctcgtgagcgagcttcgcctcat
accccgagtcctggagatttactgtctaacacacagttgcctggtcgtggggcttcacgc
gtttctcaagcggatcaacgagctgtctcgggcgcttcgatgagacggcaaggtgccaat
cccaaggatgatcggttctttaacgatccctttgactcgaggagactgggtcgtatgact
ttggatccacgagaaactgtcgacgaagataatctcttccgtgcttctatcctggagtgc
atgttcaagtcacttggactggataccaatggaagcgtgtcccgcgagccagaatccatg
gagggctcccctaagttggtttcagtcgatcatcggcgatcaagatttggaaaccagagc
aatgcttttggtttcatgcctccctacgatggctccgttgatggcgacacggaatcggtg
acatcaaacgggactgccctgcacgctcctgtcagtgcccataaccttgccaacgacatg
aaagacgaggttgagattgtgtttttccccaagggctcggttcttgtagagcagggagag
cgaaaccccggtctgtactatgtcgtcgatgggttcctggacattggcacaagtagcgag
ggtgatgctcacaacattctcaagtccagcgggtttggcaaatcgcagcaagacccatca
tcgcccgacccgtctgacatgggatcatttcccactttggcgaagactgaaactgcacga
gatcaagccgaggccgagacacaacagtcagcgtccaagaagtcccgccgcagcatagct
ttggtcaaaccaggcggacttgctggctacattggcagcgtctcttcataccgatccttt
atcgacgttgtggccaagactgatgtgtatgtgggctttttgccccgagcttcgcttgag
cgcatcgtggaccgttatccaatcgtccttctcacgatggccaagcgattgaccaatatc
ctgccacgcctgatcctgcacattgactttgctctggaatgggttcaagtcaatgctggc
caggttctcttccacgaagccgatgaaagcgaagccatctacatcgttctcaacggacgc
ttgcgtatggtccaagaacgcaagggtggaagtggtggtgtcactgctctggctgaatat
ggccaaggtgacagcgttggtgaacttgaggtgctcacggagaccgcccgcccaggtact
ctgcacgctattcgagacacggagctggtaaaattccctcgcacgctgttcaacagcttg
gcacaggaacaccccaatatcacgatcaagatctcaaagatcatcgcatccagaatgagg
gccattgttgatgacacctccaaattctcctccaaggacgccagtacaagccccaagaca
ttgatgcgaaagtcgaacatgaatcttcgaacagtggccatccttcctgtcacggctggc
gtacctgttgttgagtttggaaaccgtctgatgaacgccctcgctcaagttggtccagcc
aatggtgccacttcccttaaccaggctgctattctcaaccatctcggcaagcatgctttt
aacaagatgggaaagctcaggctttctcaatatcttgccgacttggaagaaaaatacggc
ctggttgtttatgttgcagataccaacgtcaactccccatggacgcagacttgtatcacg
caagcagatagcattctcctggtgggccttgcagaaggatcaccagcaattggtgagtac
gagcgcttcatgcttggcacgaagtctacagctagaaaggttctggtcctgttgcatgcc
gaacgttactcccggcctggcctcacccgtgcttggctccagaatcgtatgtggatcaat
ggaggtcattgtcacatccaaatggcctttaggacaaaccagatgccagtgcatgccccg
aagaaactcggtcaagctctcaaggagcgtgtgcaggtgttgcaggctgaaatacagaaa
tacacctcacgcaaggtgcatcatactccgtactattcgcccgattcgcctttcaaggga
gatttccaccgcctggcacgacggctgtgtggcaaatcaattggacttgtacttggcgga
ggtggtgcacgaggtatcacccaaatcggtatcatccgggccatggaagaggccggaatc
cctattgatctggtcgggggaacctcaattggtgcctttgttggagccctctatgctcgt
cacgcggatgttgtgcccatgttcggattcgctaaaaagtttgctggacgaatggccagt
ctttggcgtttcgctctggatttgacttatccttccgcctcgtacactacaggacacgag
ttcaaccgtggcattttcaaagcacttggtgacacacaaatggaagacttctggcttgag
tactactgcaacacaactaacatcagtaagagtcgggcggagtttcacaccagtggttat
gcctggaggtatatccgagcctccatgtcccttgccggtttacttccacctctgtgcgac
gagggtagtatgctacttgacggtggctacattgacaatttgaccgtgtcgcacatgaag
ggtcttggagttgacataatctttgctatcgacgtaggtgccttggatgatgatacaccg
caaacatatggtgactcgctgtctggagcgtgggcgtttgtcaatcgatggaatccgttc
tcgcctcacccgaaccctccaacccttgcggagattcagggacgactagcatatgtgtcg
agcgttgatgctctggaacgtgccaagactatggcgggatgcatctacatgcgaccgccg
attgatgactatggaacgctcgacttccacaagtttgatgaactgtaccagctgggatac
aaatatggacaagagtttttcaacaagatgaaagagcaaggagtcttgcccttggtagaa
gagacggaggccaagaaagcgctgagacgcacgatggcaccgcgacgagcgagtatctga

DBGET integrated database retrieval system