KEGG   Fusarium graminearum: FG05418.1Help
Entry
FG05418.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     FG05418.1
Protein kinases [BR:fgr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   FG05418.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 812 aa AA seqDB search
MHDAHDAHAGIKYPMRPHHQSHQSGSRPVNLHSPQESSAAQRYSPMETLSPTSPYAPKSA
SNSQFTSPTQRQSPTRQPDYSQSPYFPGARQHQPGQHLPPINPYASGGHQENYPSSAVSN
LDAAFNLDPKSPRRPVPQQVIRGPVPEFKPLSSSNELQPKVNSQPPFRRANPEGGFISPL
QALTVQLPATYRICNPSFKYESSRNPRRVLTKPSKGTKNDGYDNEDSDYILYVNDILGSE
EAGHKNRYLILDVLGQGTFGQVVKCQNLKTQEVVAVKVIKNRTAYFNQSMMEVSVLDLLN
TKLDKNDDHHLLRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLL
NGLALLNKARLIHCDLKPENILLKNLESPIIKIIDFGSACDERQTVYTYIQSRFYRSPEV
LLGLPYSSAIDMWSLGCIVVELFLGLPLFPGSSEYNQVSRIVEMLGNPPNWMIEMGKQAG
DFFEKRQDEFGRRTYQLKPMEQYARERNTKEQPSKKYFQANTLPEIIKTYPMPRKNMKQS
EIDREMNNRIAFIDFVRGLLTINPLERWSPQQAKLHPFITQQKFTGPFIPPMNLKSSSLN
RSPAPGTQQQQQAEALSKQRAQAAQQQAASAAPNPYPANANQYAQQGHAQPQMYGNNTMY
PQGSSHANMPSPYGQQHGQYGQMPIPQQPQQMPQGQYAQMPQPNMYQHQQGGIRPVRQRA
STMEQQQSGIPAAIQRVASHLDPSQPIRLQPSPAYYPPTGESMTGGNVDNRTAANRRGSR
VQQGGRGNRDFIRNLEERTLEEGFMGNQNTWH
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatgctcatgatgctcatgccggtatcaaataccccatgaggcctcatcaccag
tcccatcaatcgggcagccgtcccgttaatctccattctccccaggagtcttctgctgct
caacgatactcgcccatggagactttgtcccccacttcgccctacgcgcccaagtctgct
tccaacagccaattcaccagcccgacacagcgacaatcgcccacacgccagcccgattac
tcccagtctccttacttccccggtgctcgtcaacatcagccaggacagcatttgcctcct
atcaacccctacgcgtctggtggccaccaggaaaactatccctcatctgctgtcagcaat
ctcgacgctgccttcaacctcgatcctaagtctccacgccggcccgttcctcagcaagtg
atcagaggacctgttccagagttcaaaccattgtcgtcctcgaacgaattgcaacccaaa
gttaattcgcagccaccctttcgtcgcgcaaatcccgaaggtggctttatcagccccctt
caggctctcactgtccagctgcctgccacctatcgtatttgtaacccgagcttcaaatac
gagtcgtctcgcaacccccgcagagtgttgacaaaacctagcaagggcaccaagaacgat
ggttacgacaacgaagatagcgattatattctttatgtgaacgatattcttggttccgag
gaagctggccacaagaatcgttatcttattctggacgttttgggtcagggtaccttcggc
caagtcgtcaaatgccagaatcttaaaacacaagaggtggtcgccgtcaaggttatcaag
aaccgcactgcctacttcaaccagagtatgatggaggtttccgtccttgacttgctcaac
acgaaactcgacaagaacgatgaccaccatctgctgcgcttgaaggatacttttatccat
cgacagcatctctgcctggtttttgaacttctgagcgtgaacctctacgaacttatcaag
cagaatcagttcaggggtctcagcaccacgctggttcgcgtgtttgctcagcagcttctc
aatggcctagcgctgttgaacaaggctcgtctgattcattgcgatctaaagcctgagaac
attcttctcaaaaatcttgagagcccaatcatcaagattatcgattttggctcagcttgc
gacgagcgtcagactgtctacacttatatccagtcacgattctatcgatctccggaagtg
ctgctcggtctaccgtactcgtcagccattgatatgtggtctctgggctgtattgtggtc
gagctcttcctaggccttcccttgttccccggatcttcggagtacaatcaggtttcgcga
attgtcgagatgctgggaaacccccccaactggatgatcgagatgggcaagcaggcgggc
gacttttttgaaaagcgacaggacgagtttggtcgacggacgtatcagctgaagccaatg
gaacaatacgcccgggagcgcaatactaaagagcagcccagcaagaagtatttccaggcg
aacacccttcctgagattatcaaaacttaccccatgccccgaaagaacatgaagcaaagc
gaaatcgacagagaaatgaacaatcgcattgcattcatcgattttgttcgaggtctctta
accatcaatcctctggaaagatggtctccacagcaagccaagcttcatccttttattact
cagcagaagttcactggccctttcataccaccaatgaatctcaagtcgagctctctgaac
aggtcgccggcgcctggtactcagcagcagcaacaagccgaggcgctcagcaagcaacgg
gcgcaagcggcgcaacagcaagctgcctcggccgcccccaatccctaccctgcaaatgcc
aatcagtatgcgcagcaggggcatgcacaaccgcagatgtacggaaacaacaccatgtat
cctcagggaagcagccatgccaatatgccctcaccatatggccaacaacatggccagtat
ggacaaatgcccatcccccaacagccccaacagatgccccaaggccagtatgcgcaaatg
ccccagcccaatatgtatcagcaccagcaagggggtattagaccagtgcggcaacgcgca
tctaccatggagcagcaacagagcggcatcccagccgctattcaacgagtcgccagccat
ctcgatcccagtcaaccaatccgtctgcagcccagcccagcgtattatccacctactggg
gaaagcatgacgggtggtaacgtcgacaaccgaacggcggcaaaccgaagagggagccgc
gtacagcaagggggccggggcaacagagacttcattcgcaacttggaggaacgcactctt
gaagaaggttttatgggaaatcaaaacacctggcattga

DBGET integrated database retrieval system