KEGG   Fusarium graminearum: FG05446.1Help
Entry
FG05446.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
fgr  Fusarium graminearum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fgr00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 382 aa AA seqDB search
MKLLNLLSLAGLAAACAHDHDDKQWTKEELNELEDKWGYEWPFAGINTFAHLKHVKCLTE
PTEPFDIAIVGVPFDTAVSYRPGARFGPRAIRSASARQTSMRGFNPRAGINPYQNWAKIV
DCGDVSVTPIDNGIAREQMTQAFKQLGRRRTVSALAPKARLVTLGGDHSLALPALRALNE
IHGKPIQVLHFDAAYPSWWGATHFNHGSMFWMANQEGLLSNSSTERSVHAGLRTRLTGTD
FSDHEDDSSQGWVRFTADDIDDLGTKGIIDGILKVLGTENPVYLSVDIDVLDPAFAPGTG
TPEPGGWSTREFIRIIRGLEGLNLVGADVVEVSPAYQNGGEETALAAAQVVYEIISSMVK
RSLQDGGKEGNGGNAAEAKDEL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcttgaacctcctctcattggcggggctggcagcagcttgcgctcatgatcat
gacgataagcaatggaccaaggaggaactcaacgagctcgaggataaatggggttacgaa
tggccttttgctggcatcaacacctttgcccatcttaagcatgtcaagtgtctgactgaa
cccactgagccattcgacatcgccatcgtgggtgtccccttcgacacagccgtgagctac
cgcccaggagctcgctttgggcctcgagcaatccgctcagcatctgcccgccaaacatcg
atgcgtggcttcaacccccgagctggtatcaacccgtatcagaattgggccaagattgtt
gactgtggcgatgtttctgtcacaccaattgataacggcattgctcgtgagcagatgact
caggcgttcaagcagcttggtcgtcgtagaactgtttctgcgctggcacccaaggctcgc
cttgtgacattgggtggtgatcactcgctggctctccctgctttgcgagctctgaacgag
atccacggaaagcctatccaggttttgcactttgatgctgcctatccctcatggtgggga
gcaactcactttaaccacggctccatgttctggatggcgaatcaagaaggtttactatcc
aactcgtctactgagcgctctgtccacgccggtctgcgcacccgtctcacaggcaccgac
ttctccgaccatgaagacgattcatcacaaggctgggtccgtttcactgccgacgatatc
gatgaccttggcacaaagggcatcatagacggtatcctcaaggtgcttggtactgaaaac
cccgtctatctctccgtcgacattgacgttctcgaccctgcctttgcgcctggcacaggt
acccctgagcctggcggttggtccacccgcgaattcatccgcatcattcgtgggcttgag
ggcctgaatcttgttggtgctgatgttgtcgaggtatctcctgcttaccaaaatggaggt
gaggagacagcacttgctgctgcccaggttgtctatgagattattagctccatggtcaag
aggagtcttcaagatggcggcaaggagggcaacggcggcaatgcagctgaggctaaggac
gagttgtaa

DBGET integrated database retrieval system