KEGG   Fusarium graminearum: FG05492.1Help
Entry
FG05492.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
fgr  Fusarium graminearum
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    FG05492.1
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    FG05492.1
   04113 Meiosis - yeast
    FG05492.1
Protein phosphatases and associated proteins [BR:fgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     FG05492.1
Ubiquitin system [BR:fgr04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     FG05492.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 823 aa AA seqDB search
MAPTPTAVNGLLRQVIHYHLDNASYDNALFFSERLTAQDPRSSESAYLYSLCHLRLGDYR
SAYDVSKAIGYRGAHLGCAWVFAQACLALERYKDGLSALEKARGLWASKCSLGKHSATAR
TALPDAPAVLCLLGRLHRGYDDKKKAVSCYEEALQLNPFMWDAFSALCDLGVTVRVPTIF
KANDPIVHSFDVETNPMIYREGSVPIPSDLPAKKSQRNAAADVGNDPFSSSHNLDSLELT
NGDSSQEVHKSDFMLKIQEGRMRCTASTNSSSGFDGMETPPGPISSFTTSSRLGQSHEPP
QAPPRRTRQAQAIDQGHDAPPRMNYRIGSRRTRAQEKGQQEQSTENIMTDASNSAPSASL
RPSIPAAERKRTVSGHPAQRATNTEEPTTTRRSARLNMFRPLSKANSSATTIGTAAPREL
KKARPPISRIVRPGSSGNNVGRVVSGNRKPLEDTHVEIDHGEVQKPKDVPPPPPVHKTLE
LDAQRLEEGLKWILDLTKKLANGYYSLSQFQCTESLQHFQSLPVSHQNTPWVLAQIGRAH
YEQASYAEAEKFFRRMRVQAPSRLEDMEVYSTILWHLRRETDLSFLAHELVDSAWLSPQA
WCALGNAWSLARDHEQALKCFKRATQLDPKFAYAFTLQGHEYVTNEEYDKAQTAYRQAIS
ADKRHYNAYYGIGRVQERLGAYDKAYTHFHAAQSINPNNAVLITCIGTVLEKQKQIMPAL
QAYSKAVELAPRAAQTRYKKARALLAVGQLEQAQKELMILKDLAPDEATVHFLLGKLYRS
MGEKQLSVRHFTIALALDPKASQQIKEAIESFEDDVEMDDSMM
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggctcctaccccgacggccgttaatggccttctaagacaagtgatacattaccatctt
gacaacgcctcatacgacaacgcccttttcttctccgaacgcttgacggcacaagaccca
aggtccagcgagtctgcatacctctactcgctatgccatttgcgtcttggtgactatcgc
tccgcttacgacgtgagcaaggccataggatatcgaggtgctcatttgggctgtgcctgg
gtattcgcccaagcatgtttggcactcgaaagatataaggacggcctatcggccttagaa
aaggctcggggcctctgggcgtcaaaatgcagcttgggaaaacacagcgcgacggcccga
acggctcttcctgatgcgcctgcagtactatgccttctgggaagactgcaccgcggctat
gatgacaagaaaaaggccgttagctgctatgaagaggctctgcaactcaaccctttcatg
tgggatgccttctcagctttatgtgaccttggtgttacagttcgcgtaccaactattttt
aaagccaacgaccccattgtccatagcttcgatgtggaaacaaacccaatgatatacagg
gaaggctccgtgccaatcccttccgacctacccgcaaagaagtcgcaaagaaacgctgca
gcggatgttgggaacgatccgttcagctcaagtcacaaccttgacagcctcgagctgaca
aacggcgattctagtcaggaagtccacaaaagcgacttcatgctgaagattcaggaggga
cgtatgcgctgtacagcatcaactaatagtagctctggcttcgacggaatggagacacct
ccaggcccgatatcatcattcacgacatcatcccgcctcggccaatctcatgagcctccc
caagcaccgcctcgccggacacgacaagcacaagctattgaccaaggacatgacgctcct
ccacgaatgaactaccgtataggttctcggcgcacaagggcgcaagagaagggacagcaa
gagcagtcaaccgaaaacataatgactgacgcatccaactcggcaccttccgcatcgttg
cgaccgtccataccagcagcggaaaggaaacggactgtatcaggacaccccgcacaacga
gcgacaaatacagaggagccgacaacaacgcggcgtagtgcgagactcaacatgttccgc
ccattatccaaagcaaactcaagcgcgactacaataggaacggcagcccccagggaattg
aaaaaggcgagaccccccatctctcgaatcgttcgacctggttccagtggcaacaatgtt
ggccgtgtggttagtggtaatcgcaaacctctagaagatactcatgttgagattgaccac
ggcgaagtccaaaaacccaaggacgtaccgccacctcctcccgttcacaagacattggag
ttggatgctcaaaggctcgaagaagggcttaaatggatacttgaccttacaaagaagctg
gcgaatggatactattcattgtctcaattccaatgcaccgagagccttcaacatttccaa
tcccttcctgtgtctcatcagaacaccccctgggtgcttgctcaaataggacgggcgcat
tatgagcaggcttcatacgccgaggccgaaaagttcttccggagaatgcgagtgcaagcg
ccttcccgtctcgaggatatggaggtgtattcgaccatcttgtggcatttgagacgggag
acagacctctcatttctggcgcatgaacttgtggactcagcctggctgtccccacaggct
tggtgcgcacttggcaatgcctggtcattagcacgcgatcacgagcaagctctcaagtgt
ttcaagagagcaacccaactggaccccaagtttgcatacgcttttaccttacaaggacac
gagtacgttacgaatgaagaatatgacaaagcgcagacggcgtaccgacaagcgatatct
gccgataagcgccactacaatgcctactatggtattggaagagttcaggaacgtctcggt
gcatacgacaaggcgtatacgcactttcatgccgctcaaagtatcaatcctaacaacgca
gtcctgatcacctgtatcggaacagtgttggagaagcagaaacaaataatgcctgctctt
caagcatacagtaaagcagtagagcttgccccccgcgccgcccaaacacggtacaagaag
gccagagcgctacttgctgttggccagctcgaacaggcacagaaggagttgatgatattg
aaggacttggcaccagacgaagcaacggtccactttcttctcggcaaactgtatagaagc
atgggcgagaagcagctctcagtgcggcactttactattgctcttgccctggatcccaag
gcaagccagcagatcaaagaagccattgagagtttcgaggacgacgtggagatggacgac
tcaatgatgtga

DBGET integrated database retrieval system