KEGG   Fusarium graminearum: FG05492.1Help
Entry
FG05492.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
fgr  Fusarium graminearum
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:fgr04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:fgr04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:fgr04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 823 aa AA seqDB search
MAPTPTAVNGLLRQVIHYHLDNASYDNALFFSERLTAQDPRSSESAYLYSLCHLRLGDYR
SAYDVSKAIGYRGAHLGCAWVFAQACLALERYKDGLSALEKARGLWASKCSLGKHSATAR
TALPDAPAVLCLLGRLHRGYDDKKKAVSCYEEALQLNPFMWDAFSALCDLGVTVRVPTIF
KANDPIVHSFDVETNPMIYREGSVPIPSDLPAKKSQRNAAADVGNDPFSSSHNLDSLELT
NGDSSQEVHKSDFMLKIQEGRMRCTASTNSSSGFDGMETPPGPISSFTTSSRLGQSHEPP
QAPPRRTRQAQAIDQGHDAPPRMNYRIGSRRTRAQEKGQQEQSTENIMTDASNSAPSASL
RPSIPAAERKRTVSGHPAQRATNTEEPTTTRRSARLNMFRPLSKANSSATTIGTAAPREL
KKARPPISRIVRPGSSGNNVGRVVSGNRKPLEDTHVEIDHGEVQKPKDVPPPPPVHKTLE
LDAQRLEEGLKWILDLTKKLANGYYSLSQFQCTESLQHFQSLPVSHQNTPWVLAQIGRAH
YEQASYAEAEKFFRRMRVQAPSRLEDMEVYSTILWHLRRETDLSFLAHELVDSAWLSPQA
WCALGNAWSLARDHEQALKCFKRATQLDPKFAYAFTLQGHEYVTNEEYDKAQTAYRQAIS
ADKRHYNAYYGIGRVQERLGAYDKAYTHFHAAQSINPNNAVLITCIGTVLEKQKQIMPAL
QAYSKAVELAPRAAQTRYKKARALLAVGQLEQAQKELMILKDLAPDEATVHFLLGKLYRS
MGEKQLSVRHFTIALALDPKASQQIKEAIESFEDDVEMDDSMM
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggctcctaccccgacggccgttaatggccttctaagacaagtgatacattaccatctt
gacaacgcctcatacgacaacgcccttttcttctccgaacgcttgacggcacaagaccca
aggtccagcgagtctgcatacctctactcgctatgccatttgcgtcttggtgactatcgc
tccgcttacgacgtgagcaaggccataggatatcgaggtgctcatttgggctgtgcctgg
gtattcgcccaagcatgtttggcactcgaaagatataaggacggcctatcggccttagaa
aaggctcggggcctctgggcgtcaaaatgcagcttgggaaaacacagcgcgacggcccga
acggctcttcctgatgcgcctgcagtactatgccttctgggaagactgcaccgcggctat
gatgacaagaaaaaggccgttagctgctatgaagaggctctgcaactcaaccctttcatg
tgggatgccttctcagctttatgtgaccttggtgttacagttcgcgtaccaactattttt
aaagccaacgaccccattgtccatagcttcgatgtggaaacaaacccaatgatatacagg
gaaggctccgtgccaatcccttccgacctacccgcaaagaagtcgcaaagaaacgctgca
gcggatgttgggaacgatccgttcagctcaagtcacaaccttgacagcctcgagctgaca
aacggcgattctagtcaggaagtccacaaaagcgacttcatgctgaagattcaggaggga
cgtatgcgctgtacagcatcaactaatagtagctctggcttcgacggaatggagacacct
ccaggcccgatatcatcattcacgacatcatcccgcctcggccaatctcatgagcctccc
caagcaccgcctcgccggacacgacaagcacaagctattgaccaaggacatgacgctcct
ccacgaatgaactaccgtataggttctcggcgcacaagggcgcaagagaagggacagcaa
gagcagtcaaccgaaaacataatgactgacgcatccaactcggcaccttccgcatcgttg
cgaccgtccataccagcagcggaaaggaaacggactgtatcaggacaccccgcacaacga
gcgacaaatacagaggagccgacaacaacgcggcgtagtgcgagactcaacatgttccgc
ccattatccaaagcaaactcaagcgcgactacaataggaacggcagcccccagggaattg
aaaaaggcgagaccccccatctctcgaatcgttcgacctggttccagtggcaacaatgtt
ggccgtgtggttagtggtaatcgcaaacctctagaagatactcatgttgagattgaccac
ggcgaagtccaaaaacccaaggacgtaccgccacctcctcccgttcacaagacattggag
ttggatgctcaaaggctcgaagaagggcttaaatggatacttgaccttacaaagaagctg
gcgaatggatactattcattgtctcaattccaatgcaccgagagccttcaacatttccaa
tcccttcctgtgtctcatcagaacaccccctgggtgcttgctcaaataggacgggcgcat
tatgagcaggcttcatacgccgaggccgaaaagttcttccggagaatgcgagtgcaagcg
ccttcccgtctcgaggatatggaggtgtattcgaccatcttgtggcatttgagacgggag
acagacctctcatttctggcgcatgaacttgtggactcagcctggctgtccccacaggct
tggtgcgcacttggcaatgcctggtcattagcacgcgatcacgagcaagctctcaagtgt
ttcaagagagcaacccaactggaccccaagtttgcatacgcttttaccttacaaggacac
gagtacgttacgaatgaagaatatgacaaagcgcagacggcgtaccgacaagcgatatct
gccgataagcgccactacaatgcctactatggtattggaagagttcaggaacgtctcggt
gcatacgacaaggcgtatacgcactttcatgccgctcaaagtatcaatcctaacaacgca
gtcctgatcacctgtatcggaacagtgttggagaagcagaaacaaataatgcctgctctt
caagcatacagtaaagcagtagagcttgccccccgcgccgcccaaacacggtacaagaag
gccagagcgctacttgctgttggccagctcgaacaggcacagaaggagttgatgatattg
aaggacttggcaccagacgaagcaacggtccactttcttctcggcaaactgtatagaagc
atgggcgagaagcagctctcagtgcggcactttactattgctcttgccctggatcccaag
gcaagccagcagatcaaagaagccattgagagtttcgaggacgacgtggagatggacgac
tcaatgatgtga

DBGET integrated database retrieval system