KEGG   Fusarium graminearum: FG05518.1Help
Entry
FG05518.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
fgr  Fusarium graminearum
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:fgr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1642 aa AA seqDB search
MAEITALDALQAFHQGLLSLREGRVEGAETLGNEFLVQVFETELAKFWDKPARKSDNRNA
VKSGKVVIDGDEYSINDNFQQDVLTFSDEVELDELESTRCLLESQEDPNTLGRSLLECAI
IRFHQQRKYVLDIVRLLLELEGLDDDIADAEALESVKLCMASMREIKAWLQKIGDKIAAA
QTLGQTTTNGVSEQIETIEFSRVSLMQQHELLGVILCRSIEMRQGSTQDFLDFVSVLQKV
DRYDALLVHLVPSIGAYISVFGSAEGGYDLIKARELHGKLFPTDSSPWPLSQLQAAFRAW
WLAEYSGFYVDDPPEAAIPPNTDLDEEDRQRSKAFLESLKDGSFDFLLSIAADVKSPDWH
DPVRAGMRKWLQRKSPALAPDAIPFADFFQMSLMLQLEVFVDGFISNLPDVLRKLRVEED
EQRQSSQTHEQDLDLERFLLIIAYAYEGRPDAAMNFWSDPDSNLAGFMHWASRRASTPLV
TAFCEMLQAISENEECASAAHEFLIDEGHHSSGKMRKSQSLTWAQIFKELDFFSAKIRQK
PAPPQAIRYRNEKMSSDQAETEPESAMMLECYLRLMSKLASESETTRQFLLQNPNYSLVE
TLLELASSNIPPRLRGCTFMALRALMARKSLQEGALMWNCLDQWITGEYFLHPVTSHRQS
QQSPSVFMERIFDEISNGFEDPESFIQLLLSLISPAADSSPLNDGLPFPENLGSSSRMPG
IEIYVDFVIGLVFAQKANDLQDVNQTRVLRLSCLEFILICLNTFNEDLIIMANETNINVD
SVIATTDLATYVRMHPFARVMEWMFNDKVMAALFNTIHQEPADVGNASPDSPLILGILRA
VEVISKVLDLQATYLELVRPIIKLQSNQRRPPVANAAFASFEDGLVTRLNLVVDLGNYCG
IGHPELTLACLKLLEKMSSSSKITAVWSGSSRQMHRNKAIVALEANGEHETISRSFVSEL
ITPLETGRETDSPAYVTKIYILDFLYQCLQETPRKPTIAHLLLGFKCGIDSLSVEAKGAF
TSRTSLFHTILRLLLETPSGDAQGMRQWLIAIKSRVMRILHILWSSPLSAPVVVEELREN
EILFHLLLRETVINPDLPWEGENVALVQFPVTDGAIALIDFLSLRSMSLEYIAMELCSIA
QNRMPSVKRRIFEALNGQIIGEGDTPIPIPTIFDLYDFLLPEGVWEIPLPPLQYYKDLDL
TACLENDTDGNQIYNLERVKEVLLLKRGEAHDAGTLVAAQDLVAFEREESMIIEYLISSN
RQKQLTTQSLKVLKTWTKLLLVMIESNDFKGSAQISFFLQALQSILPSLEAFASERPDEA
FELAKLSKILLFKLDLSASADDKQGSAIGNLISDKLFQLFQICLQAIGKWAGTPELRSIY
YSICYRYLTGMADQGPLTSNRPKTIKTIQVYGERLLNVICDDAYGGEAQCQTAALILLNA
LISMGHQESEGYVVETLNRLNFIGIMVDSLRNIMQEWQEVFTSGTSEQQNYQNARLALLL
ELAQTRSGAKYILHSNLFRALEISGLFGADPELQINSTNPRALEQHYDLLAQVVRIVSAA
LVARGSHNVVQGRRFLTDHRMLVTHTLKRSAGIGSANADEGLDQKIEELAEGLMVIIAAT
RFLEFENEGLPESTQQSHGLFH
NT seq 4929 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatcaccgctttagatgccctccaagctttccaccaagggcttctatcatta
cgcgaaggtcgcgtcgagggtgcagagacactggggaatgagttcctagtccaagttttc
gagaccgagttggccaagttctgggataagccggcaaggaaaagcgacaatagaaacgct
gtcaagtctggcaaagttgtcatcgacggtgacgaatactcgatcaacgataacttccaa
caagatgtccttaccttttccgacgaagtagagctcgacgagcttgaatctacacgatgt
ttactggagtcgcaagaagaccctaatacgctaggccgatcgctcctcgagtgcgccatc
atccgatttcaccaacagcgaaagtacgttctcgatattgtgcgacttctcctcgaacta
gaaggcctcgacgacgatattgccgatgcggaagcccttgaaagtgtcaaactgtgtatg
gcttccatgagggagatcaaggcgtggcttcagaagataggagacaagatcgctgcggct
cagaccctcggtcaaactacaactaacggcgtctctgagcagatagagaccatcgagttc
tccagagttagcttgatgcaacagcacgaattgttgggtgtaatactgtgccggagtatt
gaaatgagacaaggatcaacccaagactttctcgacttcgtatctgtccttcaaaaggta
gacagatatgatgccttgctggttcaccttgttccatctatcggagcatacatctcagtt
ttcgggtctgctgaaggcggatatgatcttatcaaggcccgtgagttacacggcaagctc
ttccctacggacagttctccgtggcccttgtcacagttgcaggccgctttcagggcttgg
tggcttgcagagtacagtggcttctacgtcgatgacccccctgaggcagcaatccccccc
aacactgacttggatgaggaggatcgacagcgatcaaaagcgttcctggagtctctaaag
gacggttctttcgacttcctgctctcaatcgcggccgatgttaaatcgccggattggcac
gaccctgtaagagccggtatgcgcaagtggctgcaacgaaagtcacctgctctcgccccc
gatgcaatccctttcgccgatttcttccagatgagtcttatgctacagctcgaggtgttt
gttgacggcttcatctccaaccttcccgacgtgctacgaaagcttcgcgtggaggaggac
gaacaacgtcagtctagtcagacacatgaacaggatttagaccttgaaagattcttgctg
atcattgcatatgcttacgagggccggcccgatgctgccatgaacttctggtctgacccc
gacagtaacctggctggttttatgcactgggcctctcgcagggcgtcgacgcctctagtg
actgcgttctgcgagatgctccaggctatctcggagaatgaagagtgcgcttctgctgca
catgagttcttaattgacgagggtcaccattcatctgggaagatgagaaaatcacagtca
ttaacatgggctcagatcttcaaggagctggactttttctctgccaaaatcaggcagaag
ccggcgccacctcaggcgatacgttatcgtaatgagaagatgagtagtgatcaagcagaa
accgaaccggagtcggccatgatgcttgaatgttaccttcgtctgatgtcaaagttggct
agtgaaagtgagacaacacgccaatttctccttcagaaccccaactatagccttgtcgaa
acattgcttgagcttgctagcagcaacattccaccccggttacgcggctgtacttttatg
gctctccgagctttgatggcacgcaagtcgctgcaggagggtgctcttatgtggaattgc
cttgatcaatggatcactggagagtatttcctccacccagttacttctcatcgtcaatcg
caacagtcgcctagtgtcttcatggagcgtatttttgatgagattagcaatggatttgaa
gaccccgaatcctttatccagctcctgctttccctcatatccccagctgcggacagcagt
cccctcaacgacgggctaccatttccagaaaaccttggctcctcctctcgaatgcccggt
attgagatttacgtcgactttgtgatagggttagtctttgcccaaaaggccaacgacctt
caagatgtcaaccaaactcgggtcttgcgtcttagctgcctcgaattcatccttatctgc
ctgaacactttcaacgaagatcttatcatcatggcaaatgaaacgaatatcaacgtcgac
agcgtcattgcaactaccgacttggcgacctatgtacgaatgcatccttttgcgagagtg
atggaatggatgttcaacgacaaagttatggcagctcttttcaacactattcaccaagag
cctgcagatgtgggaaatgcttcccccgactctcctctaattcttggcatcttgcgcgct
gtcgaagttatcagcaaggtccttgatctccaagctacctatcttgagcttgttcggccc
attattaagcttcagtcaaaccagcgtcgaccacccgtggcaaatgctgcattcgcttca
tttgaggatggcctagttacgcgactgaacctcgttgttgatttaggtaactactgtggt
atcgggcacccagaattgacgcttgcgtgcctaaagcttctcgaaaagatgtcatcatct
tcaaagatcaccgctgtttggtcagggtccagtcgacaaatgcaccgcaacaaggctatc
gttgctctagaggcgaatggcgagcacgagacaatctcaagatcgtttgtctcggaattg
ataacccctctggagacagggcgtgagacagactccccagcttatgtgaccaaaatctac
attctcgacttcctataccaatgtctacaagaaacgccccgcaagcctacaattgcccat
ctgctgcttggttttaagtgtggcattgactctctttctgtcgaagccaagggtgctttc
acttcaagaacctctcttttccacacaatactgagattgctacttgagaccccctccggt
gatgcccagggaatgcgacagtggcttattgccattaagtcacgcgtaatgcgtatcttg
catattctttggagctctcccctgtccgcccctgtggtggttgaggagcttcgcgaaaat
gagattctcttccaccttttgcttcgtgagacagtcatcaatcctgacttgccttgggag
ggtgaaaacgtcgctctggtccagttccctgtcacagacggcgctatagctttgattgat
tttttgtctcttcgaagcatgagcctggaatacatcgcgatggaactttgcagcatagcc
caaaatcgcatgccgagcgtcaagcgtcgcatatttgaagccttgaatggtcagatcatt
ggggaaggagatactcctatcccaattcctacaatctttgacctgtatgacttcttactc
ccggaaggtgtctgggaaattccattacctcctctccaatattataaagatcttgacctg
acagcctgcttggagaatgatactgacggcaaccaaatctacaacctggaacgcgtcaag
gaagttcttctactaaaacgcggcgaggctcacgatgcgggaacactagttgcagcccag
gatcttgttgcattcgaacgggaagagagcatgataatagagtacctcatttcctctaat
cgacagaagcagctgacgacacaaagcctcaaggtcctcaagacatggaccaagctgctt
ttggtcatgatcgagtcaaatgacttcaaaggctcggcacagatttccttcttcctacag
gctttgcaatcgattctgcccagtttggaagcgtttgcttctgagcgaccagatgaggcc
tttgagctcgcaaaattatccaagattctactcttcaagctcgatctttcggcgtcggcg
gatgacaagcaaggctcagccattggcaatctgatcagcgacaagcttttccagcttttc
cagatctgtctgcaagccattggcaagtgggctggtacgccagagctaaggtccatctac
tacagcatctgctaccgctacttgactggcatggctgaccaagggccactcacgtctaac
cggcccaagaccatcaagaccatccaagtgtatggtgagcggttactcaatgttatttgt
gatgatgcatacggcggcgaagcgcagtgtcagacagcggcgctcatcctcctcaacgca
ttaattagcatgggtcaccaggagagtgagggttatgttgtcgagactctcaatcgactc
aactttatcggaatcatggtcgactcgctgcgaaatatcatgcaagagtggcaagaagta
ttcacgtcaggcacttctgagcagcagaattatcaaaacgcacgtcttgctcttctcctt
gaacttgctcaaactcgttccggggccaagtatatccttcattccaatcttttccgtgct
cttgagatctctggcctcttcggggcagaccctgagctgcaaatcaacagcacgaacccg
cgcgccctcgagcaacattacgatctcctcgcccaagttgtgcgcatcgtaagcgccgca
cttgttgcccgtggcagccacaatgttgttcaaggccgccggttcctcaccgaccatcgc
atgctcgtcacacatacacttaagcgcagcgctggcatcggaagcgccaacgctgatgaa
ggcctggaccagaagattgaagagttggctgaagggttaatggttatcattgcagcaaca
cgattccttgagtttgagaacgagggcctccctgagtctacgcagcagagccatgggctt
ttccactag

DBGET integrated database retrieval system