KEGG   Fusarium graminearum: FG05558.1Help
Entry
FG05558.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
fgr  Fusarium graminearum
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:fgr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1051 aa AA seqDB search
MNLVEKATSLRVNKHKHVGTSKKFIQPSVGPIVSEDRGHKIPTNATICSSFDQVGESVLD
SNWLRPSHRIAYARSTTFNTPLIPLAVFARIIPRVCIDSSTRLFASRQYLGQTSTPRSKL
GLWAIASDVLMEDDEYTTSKMEEIKLEEGANDAQVKQETNTPMSITNGDHESSRSPTASQ
DGLKSRSESADTPSSNRPSKLSRKASQKLAASREPVLFDHLPDMTTESCKFFQRIPDCLY
GSKHLGSTDNDALDCECRDEWHDGKNLACGEDSDCINRATKMECSAEGGNCAGGCQNQRF
QRKQYANVSVIKTEKKGFGLRADSDLQPNDFVFEYIGEVINEPTFRRRMIQYDEEGIKHF
YFMSLNKSEFVDATKKGNYGRFCNHSCNPNCYVDKWVVGDKLRMGIFTSRKIQSGEELVF
NYNVDRYGADPQPCYCGEPNCVGFIGGKTQTERATKLPAATVEALGIDGGDGWDTSVAKK
PRKKKPDEDDEEYVNSIRPRSLSEDDARKVMAALMQCKEKWIAVKLLDRIMQCDEERVIH
CVMRMHAYQILKTTLNTFIDDHNVVLQVLDILDKFPRLTRNKVQDSKIEATIEGLTQSEH
EDVASKSKHLLNEWSKLEVAYRIRRRKFDPNAPAANSFEERRGAGREEETVQSTSKTASP
TPIDAPKGPRNSMPQRNNAFFQNGGRSRRPPFNASLPQGWFTAKDAAGNTYFYTKQGATT
WQRPTQPATEPAAKAPSKAMKEQLAIQSIINQVTEKGTPKHTSVSTPKAAETPPKEVKEE
KWRSLPVDKRMKIYENTLFPHIKHVLDKFHHKLPKEELKRFGKDIAKKLVASDFKNNRVE
DPGAPLSDKQVKKIKQYVKDFLDRAVKKYGEHKRKADEDADTQMKDDQGPSAAGSGAGSV
VDGSDGTALAKVDGTSMGEVDVTAVSDREGTGSLGSPDRKRKRDLDTSGSPYVTSTDGPN
MKRLREDELEAPSPPPPPPPPPQSDMDEVVTAEQEALREQEEALMRENEEAQRLEDEASH
TKGLEDVLDASNEISRLNKEARKPGSQKMPA
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgaacttggtggagaaagcaacgagtctgcgtgtaaacaagcacaaacatgttggtaca
tctaaaaagttcatacaaccctcggtcgggcctattgtgtcggaggaccggggtcataaa
attccgaccaatgctactatttgctcttcctttgaccaggtcggcgaaagcgttctcgac
tcgaattggcttcgtccctcgcatcgtatcgcgtatgcccgctccactacatttaacact
ccactcatcccgttggctgtctttgcccgaatcatccctcgcgtttgcattgactcctca
acacgtcttttcgcctcgcgacagtacctcggacaaacctcgacaccacgctccaaactc
ggcctttgggctatcgcttctgatgtactaatggaggatgacgagtataccaccagcaaa
atggaggaaatcaagcttgaggagggcgcaaacgacgcgcaggtgaagcaggagaccaac
acccccatgagcatcacgaatggtgaccacgaaagctcccgctcgccgaccgcttctcag
gacggcctcaagtcgcgcagcgaaagcgcagacacgccaagctcaaacaggccctcaaag
ctttctcgaaaggcttctcagaaattagccgccagtcgcgaacctgttctgttcgaccac
ctccccgacatgaccacagagtcctgtaaattcttccagcgcatccccgactgcctctac
ggctcaaagcaccttggatctacagataacgacgccttggactgcgagtgtcgggatgaa
tggcacgatggcaagaaccttgcctgtggcgaggattcggactgtatcaaccgggcgaca
aaaatggagtgcagcgctgagggaggaaattgcgcagggggctgccagaaccaacggttc
cagcgcaagcagtacgccaatgtgtcggtcatcaaaactgaaaaaaaggggtttggccta
cgcgccgattcggatctacaacccaacgacttcgtttttgagtacatcggcgaggtcatt
aacgagcctacttttcggcgccgcatgatccagtacgatgaggagggtatcaagcacttt
tatttcatgtccctgaacaagagcgagtttgtcgacgcaacaaaaaagggcaattacggt
cgcttttgcaaccactcttgcaaccctaattgctatgttgataagtgggtggtcggcgac
aaacttcgcatgggcatattcacctcgcgcaagattcaatctggagaagagttggtgttt
aactacaatgttgaccgctacggtgcggatccccaaccttgctactgcggggaacccaac
tgcgtgggtttcattggaggcaagacacaaactgagcgggccaccaagcttcctgcagcc
acagttgaggctctgggtatcgatggaggcgatggctgggatacttcggtcgccaagaag
ccccgaaagaagaagcccgacgaggacgatgaggaatacgtcaacagcatacgaccgcgc
agtctcagcgaggatgatgctcgaaaagttatggccgcgcttatgcagtgcaaggagaaa
tggattgcagtaaagcttctggatcgtatcatgcagtgcgacgaggaacgcgtcattcac
tgcgttatgcggatgcatgcttaccaaatcctgaaaacgacacttaacacgtttattgat
gaccacaatgtcgtccttcaggttttggacattctcgacaagttcccccgcctgactagg
aataaagtccaagattccaagattgaggcaaccattgaaggtctgacccaatccgagcac
gaagacgtcgcatcaaaatccaaacatttgctcaatgaatggagcaaactagaggtggcg
taccgaatccggcgacgcaaatttgatcccaatgcaccagctgcaaactcattcgaggaa
cgtcgcggagcaggtcgtgaagaggagacagtccagtctacttccaagactgcatcgcca
actcccatcgacgcgcccaagggtcctagaaacagcatgccccaaaggaataacgcgttt
ttccagaacggcggtcgttctaggcggcctccgtttaacgcatcacttcctcaagggtgg
ttcactgccaaggacgctgctggtaacacctacttttataccaagcagggtgccactacc
tggcaaagacctacccagcccgccacagagcccgctgcaaaagcaccttccaaagccatg
aaggagcaattagcaattcagagtattatcaatcaggttactgaaaagggaaccccaaaa
catacttccgtgtcaactccgaaggcggccgaaacaccgcccaaggaggtgaaagaggag
aaatggcgatcgcttccggtcgacaaacggatgaagatttacgagaatactctgtttccc
cacatcaagcatgtcctcgacaaattccatcacaaacttcctaaggaggagctgaaacgc
tttggtaaagatatagctaagaagctggtcgcgtccgactttaagaacaaccgagtcgag
gaccctggtgcacctctcagtgacaagcaagtcaaaaagataaagcagtatgtaaaagac
tttttggaccgtgccgttaagaaatacggcgagcataaacggaaagcggacgaagacgca
gatacccagatgaaagacgatcaaggacccagtgctgcaggtagcggcgctggttccgta
gttgatgggtcagacggcaccgctctagctaaggttgatggaacgtcgatgggcgaagta
gacgttactgcggtgtcagacagggagggcactggttctctgggcagtcctgatcgtaag
cgaaagagggatttagacacaagtggctcgccgtatgtcacttcgacggatgggccgaac
atgaagagactgagagaggacgagctggaagcgccaagtccgccacctcctcccccgcct
cctccacagtcagatatggatgaggttgtcactgctgagcaggaggctcttcgtgagcag
gaagaggcattaatgagggaaaacgaagaggcacagaggcttgaggacgaagcttcccat
acgaagggattggaggacgtattggatgcttccaacgagatatctcggcttaataaggag
gctcgaaagcccggctctcagaagatgccggcgtga

DBGET integrated database retrieval system