KEGG   Fusarium graminearum: FG05619.1Help
Entry
FG05619.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
fgr  Fusarium graminearum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    FG05619.1
Exosome [BR:fgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   FG05619.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1683 aa AA seqDB search
MAPLPIKFQELVQLANVGVDTQSIGFNSCTLESDSYVCVREKKSEAAQPEVVIIELKNGN
NVTRRPIKADSAVMHWNRQVIALKAQSRTLQIFDLEQKKKLKSCTMNEDVQFWKWISENE
LGLVTTSSVYHWNVYDAGQDAPVKVFERNANLNGCQIINYRVNSDGKWMVVVGISSQQGR
VVGAMQLYSKDRGISQAIEGHAAAFGTLRLEGAPQDTKLFSFAVRTATGAKLHIVEVDHP
ESNPVFQKKAVDMFFPPEATNDFPVALQVSQKYGVVYMVTKYGFIHLYDLETASCIFMNR
ISSETIFTTCTDDGSSGIVGINRKGQVLFVTIDDSNVIQYLLQNPANTDMAIKMASRAGL
PGADNLYARQFEQLFNSGDYLAAAKVAANSPRGFLRSAETIEKFKRLPVQPGQMAFTLQY
FGMLLDKGSLNKHETLELAQPVLQQNRKHLLEKWLKEGKLDCSEQLGDMVRPYDVNMALT
IYLKAEIPQKVVAGFAETGQFDKILPYSAQSGFQPDYIQLLQHITRVNPEKGAEFASALA
NSEQGPLVDFERVCDIFQGQGMIQQATAFLLDALKENKPEHARLQTRLLEMNLMHAPQVA
EAILGNEMFTHFDKTRIAQLCEQANLPQKALELYEDPEAIKRVVVNIPGQPNFNPEWLTT
FFGKLSVEQSLDCLDAMMKANIRQNLQSVVTIATKYSELLGPVRLIDLFEKYKTAEGLFY
YLGSVVNLSEDPDVHFKYIEAATKMGQFNEVERLCRDSSVYNPEKVKNFLKEAKLPEQLP
LIIVCDRFNFVHDLILYLYQSQQFAAIETYVQQVNPGRAPEVVGGLLDVDCDENVIKQLL
SSVNPQSINIDNLVSEVESRNRLKLLLPFLEATLQAGNQQQAVYNALAKIYIDSNNNPEK
FLKENDQYDTLTVGKYCEKRDPNLAYIAYSKGQNDLELVNITNENSMYRAQARYLLERSD
AELWGFVLSENNIHRRSVVDQVTATAVPEANDPSKVSVAVSAFLENDLPLELIELLEKIV
LEPSPFSDNQNLQNLLMFTAAKADKARVMDYIHKLDNYNADEIATSCIEVGLFEEAFEIY
KKADNKSAAVDVLIENVVSIDRAQAYAEEVDLPEVWSKVAKAQLDGLRVSDSIESYIKAE
DPRNYLEVIEVATHAGKNEELVKYLRMARKTHREAAIDTALAFSYARLEQLSELEDFLRA
TNVANIEESGDKAYEEGLYEASKIFYTSISNWAKLATTLVHLGDYQAAVECARKANNIKV
WKQVHEACVEKKEFRLAQICGLNLIVDAEQLQTLVKEYERNGYFDELISLLEQGLGLERA
HMGMFTELGIALSKYHPDRLMEHIKIFWSRMNLPKMIKACEEANLWPELVFCYYHYDEFD
NAALAVIERPENSWDHQQFKEIVVKVANLEIYYRAIKFYVEQHPSLLTDLLATLTPRIDV
NRVVKIFQKNDDLPLIKPFLLNVQSQNKRVVNEAVNDLLIEEEDYKTLRDSVQNYDNYDA
TELASRLEKHDLIFFRQIAASIYRKNKRWEKSIALSKQDKLYKDAIETSALSAKVDIVSD
LLQYFVDIGHRECYTGMLYACYDLIRPDLVLELSWRHGLMDFSMPYMINMLAQQTKDLAA
LKADNEARKAKEQEKEKTDDNTPILGASRLMITAGPGGMGSAPSPAPYGQPNGFAPQPTG
YGF
NT seq 5052 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctctgcccatcaagttccaggagctcgtccagctcgccaacgttggcgtggac
acccagagcatcggcttcaactcctgcacactcgagtccgattcatatgtgtgtgttcga
gagaagaagagcgaagccgcccaacccgaggttgttatcatcgagctcaagaatggtaac
aatgtcacccggcggccaatcaaggccgacagtgccgtcatgcactggaaccgacaagta
attgctctcaaggcgcagtctagaaccctgcagatcttcgaccttgagcagaagaagaag
ctcaagtcatgcaccatgaatgaggacgtgcagttctggaagtggattagcgagaacgag
cttggccttgtcacgacatccagtgtctatcactggaatgtctacgatgctggccaagac
gcacccgtcaaggtgttcgagcgtaatgccaacctcaacggctgccaaatcatcaactac
cgagttaacagcgacggaaagtggatggtggtggtgggcatctcatcccagcaaggacgt
gtggtcggtgccatgcagctctactctaaggaccgtggaatcagccaggccatagaaggt
cacgcagccgcctttggcactcttcgactggaaggtgccccccaagacacgaagctgttc
agttttgcagtacgaaccgcaacaggtgccaagctgcacatcgtcgaggttgaccatccc
gagtcgaatcctgtctttcagaagaaggctgttgatatgttcttccctcctgaggccacg
aacgatttccccgtcgcacttcaagtttcgcaaaagtacggcgttgtttatatggtaacc
aagtatggcttcattcatctctacgatctcgaaaccgcctcatgcatcttcatgaaccga
atttcgagcgagacaatattcacaacatgcacagacgatggttcttctggcatcgttggt
atcaaccgaaagggccaagtgctcttcgtgaccatcgacgatagcaacgttatccaatac
cttctacaaaaccccgccaacaccgatatggctatcaagatggcctcgcgagccggactt
cctggtgccgataacctgtacgctcgacagttcgagcagctcttcaactctggcgactac
ttggctgctgctaaggtcgctgccaactctcctcgaggtttcctccgaagcgccgagact
atcgagaagttcaagcgcttgcctgttcagcctggccagatggctttcacacttcaatac
ttcggaatgcttctcgacaagggctcccttaacaagcatgagaccctcgagcttgcacaa
cccgttctccagcagaaccgcaagcatctgcttgagaagtggttgaaggagggcaagttg
gactgctctgagcagcttggtgacatggttaggccttacgatgtcaacatggccttgaca
atctaccttaaggcggagattccccagaaggtcgttgctggcttcgctgagactggtcaa
ttcgacaagatccttccttactctgcccagagcggctttcagcctgattacatccagttg
ctccagcatatcacccgtgtcaaccccgagaagggtgctgagtttgccagtgcccttgct
aacagtgagcaaggcccattggtcgacttcgagcgtgtgtgcgatatcttccaaggacag
ggcatgattcaacaagccaccgccttcttgttggatgcattgaaggagaacaagcccgag
cacgcccgtctacagacccgccttctcgagatgaacttgatgcatgcaccccaggttgct
gaagctattctcggtaacgagatgtttactcacttcgacaagactcgcatcgctcagctt
tgcgagcaggctaaccttccccagaaggcgctggagctttatgaggacccagaggccatc
aagcgggttgttgttaacatccctggtcaaccaaacttcaaccctgagtggctcaccaca
ttctttggtaagctctctgttgagcagtccctcgattgtcttgatgctatgatgaaggcg
aacattcgccagaacttgcagtcagttgttactattgccaccaagtattcagagctactg
ggacctgttcgtttgattgatctcttcgagaagtacaagactgctgagggtctcttttat
tatcttggcagtgtcgtgaatctttctgaagaccctgatgtccacttcaagtacattgaa
gccgcgaccaagatgggacaattcaacgaggttgagcgattgtgccgtgatagctccgtc
tacaaccctgagaaggtcaagaatttcctcaaggaagctaagctgcctgagcagcttcct
cttatcattgtctgtgaccgcttcaactttgtccatgacttgattctgtacctgtaccag
agccagcagtttgcggccatcgagacctacgtccagcaggtcaaccccggccgagcccct
gaggttgttggcggtctattggatgttgactgcgacgagaacgtcatcaagcagcttctg
agctctgtcaaccctcagagtatcaacattgacaaccttgtatcagaagttgagtctcgc
aaccgccttaagctgcttttgcctttcctcgaggccactctccaggctggtaaccagcaa
caggctgtgtacaacgctcttgccaagatctatatcgactccaacaacaaccccgagaag
ttcctcaaggagaacgaccagtacgatacccttactgttggaaagtactgtgagaagcgt
gatcccaacctggcctacatcgcctactccaagggccagaatgatcttgagcttgtcaac
atcaccaacgagaactccatgtacagggctcaggctcgatacctcttggagcgctccgat
gctgagctctggggcttcgttctgagcgagaacaacattcaccgtcgttctgttgttgat
caggtcaccgctacagctgttcctgaggccaatgacccctccaaggtctccgttgctgtt
tctgctttcctggagaatgaccttcctctcgagcttatcgagctcctcgagaagattgtc
ctcgagccctcacccttcagtgacaaccagaacctccagaacctgctcatgttcactgcc
gccaaggctgacaaggctcgtgtgatggactatatccacaagctcgataactacaatgcc
gatgaaatcgccactagctgtatcgaggttggtctgtttgaagaagcgttcgagatttat
aagaaggccgacaacaagtctgccgctgtcgatgtcctgattgagaacgttgtcagcatc
gatcgtgctcaggcatatgctgaggaggttgatctccctgaggtctggagcaaggttgcc
aaggcacaacttgacggcctccgcgtttccgattccatcgagtcttacatcaaggctgag
gaccccagaaactaccttgaggtcatcgaagtcgccacacacgctggtaagaacgaggag
ctcgtcaaatacctgcgcatggctcgcaagacccaccgcgaggctgctattgacacagct
ctcgccttctcttacgctcgtctcgagcaactatccgagcttgaggacttcctccgtgcc
acaaacgtggctaacatcgaggagtctggtgacaaggcatatgaggaaggcttgtacgag
gcttcgaagatcttctacactagcatctcgaactgggctaagctggccactacccttgtc
catcttggtgactaccaagctgccgtcgagtgcgctcgcaaggccaacaacatcaaggtg
tggaagcaggtccacgaagcctgtgtggagaagaaggagttccgccttgcccagatttgt
ggtctcaacctgattgtcgatgctgagcaacttcagactctggttaaggagtacgagcgc
aacggttacttcgatgagctcatcagccttctcgagcagggtcttggcctcgagcgtgct
cacatgggaatgttcactgagcttggtattgctctctccaagtaccaccctgaccgtctg
atggagcatattaagatcttctggtctcgcatgaatctgcccaagatgatcaaggcctgc
gaagaggctaacctttggcccgagcttgttttctgctactaccattatgatgaatttgac
aacgctgctcttgccgtcattgagcgacccgagaactcttgggaccaccaacagttcaag
gagattgtggtcaaggtggccaacttggaaatctactaccgtgctatcaagttctacgtt
gagcagcatccttctctcctcactgacctcctcgccactctcactccccgtatcgatgtc
aaccgtgttgtcaagatcttccagaagaacgacgaccttcctctcatcaagcctttcttg
ctgaacgtgcaatctcagaacaagcgtgttgtgaacgaggccgtcaacgatcttctgatc
gaggaggaggattacaagacccttcgcgactctgttcagaactacgacaactacgatgcc
acagagctggctagccgtctggagaagcatgatcttatcttcttccgccagattgctgct
tccatctaccgcaagaacaagcgctgggagaagtcaattgctctctccaagcaggacaaa
ctctacaaggacgctattgagacctctgccctctcggccaaggtcgacattgtcagcgac
ctccttcaatacttcgtcgatatcggtcaccgtgaatgctacactggcatgctttacgct
tgctacgacctcatccgccctgaccttgttctggagctctcatggcgccacggtcttatg
gacttctctatgccttacatgatcaacatgctggcccagcaaaccaaggatctcgctgct
ttgaaggcagataacgaggcccgcaaggccaaggaacaggagaaggagaagacggatgat
aacacaccgattcttggcgcctctcggctcatgatcacggctggtcctggtggcatgggc
tctgctccctcgcccgcgccgtacggtcaaccaaatggctttgcgccgcagcctaccggc
tacgggttctag

DBGET integrated database retrieval system