KEGG   Fusarium graminearum: FG05636.1Help
Entry
FG05636.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     FG05636.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1144 aa AA seqDB search
MASSSRPPLSLRRHSSIRHLRQPEHDDLAQSLNQLNISTSPGRAPSRLASEPASPFRPSG
RRTSQSPAPNARAPSRSPSQDPSLGTPTLLRKASMNSLRSSNGIGPGSTSRRSSVAHVMS
PTRRASYQEKIRPTSRSIAHDNLKAELHAHHGSITTRPTQTIVVLNDAVYGHRFSRPRTS
RAALGTIVERPERIRAAVLGVSAAYVRLGGRHCEGEYPLHPGREAEHLQGIPFRIHKTDR
TLSLLSPAVVNVHGARWMEELKTMCEAAESKLALGGKELQRPEMNRGTDKSPENFHEGDL
YLCSESLNAMEGALGAVCEAVDTVFGPGPRRAFVGVRPPGHHCSASHPSGFCWVNNVHVG
IMHAALEHGLTHAAIIDFDLHHGDGSQAITWQHNTRANNAAKNAAAWKKSSIGYFSLHDI
NSYPCEMGDEEKVRSASICIDNAHGQTVWNVHLEPWKSEEDFWKLYETRYTVLLEKVRNY
FKNQAERLRESKEPPKAAIFLSAGFDASEWEGEGMQRHKVNVPTEFYARIAQDVVKLAAE
EGLHVDGRVISVLEGGYSDRALCSGIMSHLSGLAGDQTSEQSSDSAGSFGVDMAQTSPST
VPHGFEQKSALDSIHAYDPSWWSTSNMEELEILMGDPNAAASKYPQYVTLPSYFAPTQAS
TAKSSDPTKMQRSLSKLGSATPRFPSPPPPEVPWAVATHELSKLLIPSTRETGSCKPEDL
NAEASRVRRDRQSILMGIDPRPPPKASTSRPTSRMSLRERRAKPAPPSEPTIDKPPKGRR
STMGPTTVASEKLTSLKAVARGVPSQTNSDEPGVRRSSRRLSEIPVSLTSRLSSPEAVLP
EADEYAHTVPNSPAATTATTAAPNGDLQVKKTRNPAVPRKEPAPKVPRPTKKATTATGPS
RPASAAQKAKSPERAPKNGTAGDDVDNITSGMRKIRINLITQSQKAAKARALLEAEKANG
SVSAIDQAKPVETPSTAAHPSKAQSDDPNTVIVSTEAYNHSPAQSLSINPTPPTTASSSG
IATPLQGQGPFKPSGYVSRLASPPLSSPPIPSVSVHPSAEAGDVFIPYQPEGPTPKPITQ
NEPLKWLPPNVPTSSTQTPATTPSPIKKNKLFQYASSSGIPFAPRTGHQAKGAATTKPAG
PEMK
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcatcccgcccaccactgtcgcttcggcggcattcctccatccggcatctt
agacagcccgaacatgacgacttggctcagtcgttgaatcaactcaacatctccacttcg
cccggccgagctccgtcccgccttgcctccgaacctgcctctcccttccgtccatcgggc
cgccgtacttcacagtcaccagcaccaaatgcccgagcaccttcacggagcccctcccag
gacccctctttgggcacgcctaccctcctgcggaaagcctccatgaactcattgcgctct
tctaatggaatcgggcctggttcaacttcgagacgttctagcgtggcacatgtcatgtca
ccgacacgcagggcgtcatatcaagaaaagattcggccgacatctcgttccattgctcat
gacaacttgaaagccgaattacatgcacatcatggctctatcaccacccgtccgacccaa
acgattgtggtgctaaacgacgctgtctacggccaccgtttctcccgaccccgaacttct
cgtgccgccctcggtactattgttgaacggcctgagcggataagagctgcagtgttgggt
gtgtccgcagcctatgtgcgcttgggcggtaggcattgtgaaggtgaatacccactccac
ccgggaagggaggcagagcatctccaagggatccctttccggatacacaagacggatcgc
actctttctcttctttcaccagccgtagtcaatgtgcatggagcgagatggatggaagag
ttgaagacaatgtgtgaggcggccgaatcgaagcttgcattgggtggaaaggaactccaa
agacccgagatgaatcgggggactgacaagtctcccgagaactttcatgaaggggacttg
tacctctgctcggaatctctcaatgctatggaaggcgccctcggggctgtttgtgaagcc
gtcgacacagtatttggtccgggcccgcgccgtgctttcgtaggcgttcgacccccgggt
catcactgttctgcttctcatccttctggtttctgttgggtcaataatgtccatgttggt
atcatgcacgcagctctcgagcacgggctcacgcatgctgctatcatcgactttgacctt
caccatggcgatggatctcaggctattacatggcagcataatactcgagcgaacaacgct
gccaagaatgcagcagcgtggaaaaagtcgtcaatcggctacttcagcttacacgacatc
aactcgtacccgtgtgaaatgggcgatgaagaaaaggttaggagcgccagtatctgtatc
gacaacgcacacggccaaacggtttggaacgtccacctcgaaccatggaagtcagaagag
gatttttggaaactctacgaaacgagatataccgtcctcttggaaaaggttagaaactac
ttcaaaaatcaggcagagcgattgagggaatctaaagagccacccaaggctgcaattttc
ctgtctgctgggtttgatgccagcgagtgggagggtgaaggcatgcaacgccacaaggtc
aatgttccgaccgaattttatgcgcgtattgcccaagacgttgtcaagctcgcagctgaa
gaaggcctccacgttgacggccgcgttatcagtgtattggaaggtggctacagtgaccga
gctttatgttctggcattatgagccacctcagtggactggctggtgatcagacaagcgag
caatcatcagacagcgccggctcttttggagtcgacatggctcagacgtcaccaagcacg
gtaccgcatggctttgagcaaaaatcagcattggactccatccatgcttacgacccgtca
tggtggtcgacttcaaacatggaggagctcgagattctaatgggcgaccccaatgctgcc
gcttccaaatacccgcaatatgtcacccttccatcctactttgctccgacacaggcgtca
acggctaagtcctcagatcctacgaagatgcagcgtagcttgtccaagttaggctcggcc
acgcccaggtttccatcgccaccaccaccagaagtcccctgggcggttgcaactcacgaa
ttaagcaaactccttatcccctccacacgcgaaactggtagttgcaagcctgaggatctg
aacgcagaagcaagcagggtcagacgtgaccggcaatcaatattgatgggaatcgaccct
cgccctccgcccaaggcttctacttcacgtccaacatcgcgaatgtctctgcgcgagaga
cgagccaagccagcaccaccctctgagccaaccatcgacaagccacctaaaggtcgcaga
agcacgatgggccccactactgtcgcttcagaaaagctaacttccttgaaggcggttgcc
cgtggcgttccctcacaaacaaacagtgatgaaccaggagtgaggaggtccagccggcgt
cttagcgagatcccggtgtctctcacttcacggctatcttctcctgaggcagtcctgccc
gaagctgatgaatatgctcatacggtgcccaactctcccgcggctacaacggccacaacg
gcagctccaaacggcgacttgcaagtcaagaaaactcggaatcccgctgttcctcgcaaa
gagcctgcacccaaagtaccccggcctaccaagaaagccacaacggcaaccggtccttca
cgtccagcttctgccgcccaaaaagccaagtcaccagagcgagctccaaagaatggcaca
gcgggcgatgatgttgacaacatcacttctgggatgaggaagattcgtatcaacttgatc
actcagtcccaaaaggctgccaaagcacgtgctctccttgaagctgagaaagccaacggc
agtgtctctgctatcgaccaggctaagcctgtcgaaacgccatctaccgctgcgcatcca
tcaaaagcccagtccgatgacccgaacacggttattgtgtctactgaggcttacaaccac
tctcctgcgcagtcgttgtcaatcaaccctacaccacccaccactgcttcgtccagtggc
attgccactcctttgcagggtcagggtccattcaagccttctgggtatgtttctcggctg
gcctctcctccgctgagttcgccacccattccctcggtttctgtccatcccagcgcagaa
gcaggcgatgtctttattccctatcagcccgaaggtcctacacccaagcccatcactcag
aacgagccattgaaatggctccctcctaatgtgccgacttcttctacacaaacacctgcc
acgacacccagtccaatcaagaagaataaactcttccagtacgcttcttcttctgggatt
ccttttgcaccccgcaccggacatcaggcaaaaggtgccgctactaccaagcccgcgggg
cccgagatgaagtag

DBGET integrated database retrieval system