KEGG   Fusarium graminearum: FG05713.1Help
Entry
FG05713.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fgr  Fusarium graminearum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fgr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fgr00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:fgr00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 509 aa AA seqDB search
MASDSTHTQSQVYLSTRGGDYGQSWKDLSYQELAFQIFSLYISRSEIPAEDLQGIINRSY
STFRAEEVVPLVQLKDNLHLLELFHGPSYSFKDCALQFLGNLFEYLLTRKNEGKEGKDRH
HLTVVGATSGDTGSAAIHGLRGKKDVSVTILHPKGRVSPIQELQMTTCTDANVHNLAVTG
TFDDCQDIVKALFGDPETNADLKLGAVNSINFSRILAQIVYYFHSYFTLARKDPNFKVGD
KVRFVVPTGNFGDILAGYFATRMGLPVDKLVIATNENDILDRFWKTGKYEKQPAKGPEAE
GGLEVDGVKAHEDGVKETLSPAMDILVSSNFERLLWFLAYEFAETVGMDVEFNRKQAGQE
VATWLKDLKNKGGFGPVYVDVLNSARKTFESERVSDPQTLETIKDTYQKLGYILDPHSSV
GITAALRSAERAEAKIPHISLSTAHPAKFAGAVELALKDEKDFNFNEKVLPEEFVGLEKL
PKRVSDISNDWKAVREQVKKQVAEELGGQ
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgattcgacacatactcaatcacaagtctacctctccacaagaggtggtgac
tatggtcaaagctggaaagacctctcataccaggaattggctttccagatctttagcctc
tacatctcccgaagcgaaattcccgccgaagacctacaaggcatcatcaaccgaagttac
tcgacattccgcgcagaagaagtcgtccccctcgtccaattgaaggacaacctacacctc
ctcgaactcttccacggccccagctactcctttaaggattgcgctctgcagttccttggt
aacctcttcgaataccttcttacacgaaagaatgagggcaaagagggcaaggaccgacat
catttgactgttgttggtgcgacaagtggtgataccggatccgctgctatccatggtctt
cgaggaaagaaggatgtgtctgttaccatcctgcaccccaagggtcgtgtcagccctatc
caggagctccagatgactacctgtactgacgccaacgttcacaaccttgccgtcaccggt
acctttgacgattgccaggacattgtcaaggctctctttggcgaccccgagaccaacgcc
gacctcaagcttggcgccgtcaactccatcaacttttcccgaatcctcgctcagatcgtt
tactacttccactcatacttcacccttgccagaaaagaccccaacttcaaggttggcgac
aaggtccgctttgttgtgcccactggaaactttggcgacatcctggccggctactttgcc
acccgcatgggtctccctgtcgacaagcttgttatcgctactaacgagaacgatatcctt
gatcgattctggaagactggaaagtacgagaagcagccggccaagggtcccgaggcggag
ggcggtcttgaggtcgatggtgtcaaggctcacgaggatggcgttaaggagactctcagc
cctgccatggacattttagtgtccagcaactttgagcgtcttctctggttcttggcctat
gagtttgccgagactgtcggtatggatgtcgagttcaaccgaaagcaagctggacaagag
gttgctacttggctcaaggacctgaagaacaagggtggtttcggtcctgtctacgtcgat
gttctcaacagcgctcgcaagacctttgagagtgagcgcgtcagcgacccccagaccctt
gagactatcaaggatacttaccaaaaactcggatacatcctcgaccctcactcctccgtt
ggtattaccgctgctctccgatctgccgagcgtgccgaagccaagattcctcacatctct
ctctcaacagcccaccccgccaagtttgccggcgccgtcgagcttgctcttaaggatgag
aaggactttaactttaacgaaaaggttcttcccgaggagtttgttggtcttgaaaagctg
cccaagcgggtttctgacatttcaaatgactggaaggctgtgagggagcaggtcaagaag
caagttgccgaggaacttggcggacaatga

DBGET integrated database retrieval system