KEGG   Fusarium graminearum: FG05777.1Help
Entry
FG05777.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
fgr  Fusarium graminearum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    FG05777.1
Translation factors [BR:fgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    FG05777.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 746 aa AA seqDB search
MAPSFDHLREADLDDDEFNDDDIDISDLRERFEVSLDQGYDNFVVIDGLPQVTEDQKPKL
VKFLLKKLNTVGKTREDSVHMPMGDDGKSLRFAFVEYSSPAEAAAATRQLDLTPLDKKHT
LRVNKFTDIERYGREGRIDETYQPPQIEDFTEKEHLRWFLKDPSGRGRDQFVMYRGDSVG
IYWNNEKDQPENIVERPFWTEAFIQWSPLGTYLTSVHAQGVQLWGGASWSRQARFAHPFV
NMISFSPGEKYIVTWSNRPISIPDEGHPALSIDDHGKNYVIWDIATATPLRSFANLEPPK
VEDGKPPPKMQWPAFKWSADDKYVARLNPGQSISVYELPRMNLLDKTSIKIDGVVDFDWA
PATPKRDGVKEYEQLFCYWTPEIGSNPAKVGLMSVPSKEVVRSLNLFSVSDAKLHWQSDA
AYICVKVDRHSKSKKSQATTLEIFRVKEKGVPVEVVDTIKDTVINFAWEPKGDRFAIIST
TEPVGVTAVAPKTAVSFFCPEKAKKGQQVGNFKHLRTLDKKNSNAIYWSPRGRFVVIATI
ANTQSSDLDFFDLDFEGEKPESDKDLTANLQAMNTADHYGVTDVEWDPSGRFVASWASAW
KHSMENGYHIYDFKGEALREEPLEKFKQFAWRPRPATLLTKEEQKAVRKNLREYSRVFEQ
EDADRGASADLAVVEARRRMLEEWHSWRESMEADVLEEREVLGLPKDPHAPLLEAYTKSL
DTASDEDRVIEEIVEEVIEESEEVLA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggcaccctctttcgaccaccttcgcgaggccgatcttgacgatgacgagttcaacgat
gacgatattgatatctccgacctgcgagaacgattcgaggtttccctagaccaaggctat
gacaactttgtcgttatcgatggccttccccaggtcactgaggaccagaagcccaagctt
gtcaagttcttgttgaagaagctcaacacagtcggcaagacacgcgaggactctgtacac
atgcccatgggcgacgatggaaagtctcttcgattcgcctttgtcgagtactcctcgccc
gccgaggctgccgccgctactcgccagctcgacctcacccccctcgacaagaagcacact
ctccgcgttaacaagttcaccgatatcgagcgctacggccgagaaggtcgcatcgacgag
acctaccaaccgccccagatcgaggacttcaccgagaaggagcacttgcgatggttcctc
aaggacccctcaggtcgtggccgcgatcagttcgtcatgtaccgtggcgacagtgtcgga
atctactggaacaacgagaaggatcagcccgagaacattgttgagcgaccattttggacg
gaggcatttattcagtggtctcctctgggtacataccttacctctgtccacgctcagggt
gtccagctttggggtggcgcttcatggtcgcgacaagctcgatttgctcacccttttgtg
aacatgatttctttctcccccggtgagaagtacatcgtcacctggtccaaccgacccatc
tctatccctgatgagggccaccccgctctctccatcgacgaccacggcaagaactacgtt
atctgggacatcgctaccgctaccccccttcgatctttcgccaacctcgagccccccaag
gtggaggatggcaagcccccgcctaagatgcaatggcctgccttcaagtggtctgccgac
gacaagtacgttgcccgtctcaaccccggccagtccatctccgtctacgagcttccccgc
atgaaccttctcgacaagacctccatcaagatcgatggtgttgtggactttgactgggct
cccgctacccccaaacgtgacggcgtcaaggaatacgagcagcttttctgttactggact
cctgaaattggcagcaaccccgccaaggttggattgatgagcgttccctcaaaagaggtt
gttcgatctctcaacctcttcagtgtcagcgatgccaagcttcactggcaatccgacgct
gcctacatttgtgtcaaggttgaccgacactcaaagtccaagaagtctcaagccacaact
cttgagatcttccgagtcaaggagaagggtgtccctgttgaggtcgttgacaccatcaag
gataccgtcatcaactttgcttgggaacccaagggtgaccgattcgccatcatctccaca
accgagcctgtaggcgtcactgccgtcgctcccaagactgccgtctctttcttctgcccc
gagaaggccaagaagggccagcaagtgggtaactttaagcacctccgaacactcgacaag
aagaacagcaacgccatttactggtcacctcgtggtcgttttgttgttatcgccaccatt
gccaacacacagagctccgacctcgacttcttcgacctcgactttgagggcgagaagccc
gagtccgacaaggaccttaccgccaacctccaggctatgaacactgccgatcactacggc
gtcacagatgtcgagtgggacccctcaggtcgtttcgtcgcctcctgggcatctgcctgg
aagcactctatggaaaacggataccatatctacgacttcaagggtgaggctctgcgagaa
gagccccttgaaaagttcaagcagttcgcgtggcgccctcgccctgctactctccttact
aaggaggagcagaaggcggtccgcaagaacctccgagaatacagccgtgtctttgagcaa
gaagatgccgaccgtggtgcttctgctgatttggccgttgtcgaggctcgtcgccgtatg
cttgaggagtggcacagctggcgcgagtctatggaggccgacgtgctggaagagcgcgag
gttctcggcctaccaaaggatcctcacgctcctctgctagaggcctacacaaagtccctg
gatacagcatcagatgaggatcgggtgattgaggagattgttgaggaggtgattgaggag
agtgaggaggtgctcgcttag

DBGET integrated database retrieval system