KEGG   Fusarium graminearum: FG05854.1Help
Entry
FG05854.1         CDS       T01038                                 

Definition
similar to (NCU07774.1) GTP CYCLOHYDROLASE I (GTP-CH-I)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fgr  Fusarium graminearum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FG05854.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     FG05854.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 125 aa AA seqDB search
MVIVKDIEVFSLCEHHLVPFTGKMHIGYIPNETVIGLSKLPRIAEMFARRLQIQERLTKE
VAHAIMEILKPQGVAVVMESSHLCMVMRGVEKTTTSTITSCVLGCFERKSKTRNEFLNLI
GINKR
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgtcaaggacattgaagtcttttctctctgcgaacaccatctcgtaccattc
acaggcaagatgcacatcggctacatccccaacgagaccgttatcggcctttccaagctc
ccccgaatcgccgagatgtttgcccgccgtcttcagatccaggagcgcctgaccaaggaa
gtcgcccacgccatcatggagatcctcaagccccagggtgtcgccgtggtcatggagtcg
agccacctgtgcatggtgatgcgcggcgtcgaaaagaccaccaccagcaccatcaccagc
tgcgttctcggctgcttcgagcgcaagtccaagacgcgcaacgagttcctcaacctcatc
ggtattaacaagagataa

DBGET integrated database retrieval system