KEGG   Fusarium graminearum: FG05898.1Help
Entry
FG05898.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
fgr  Fusarium graminearum
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    FG05898.1
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    FG05898.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     FG05898.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1111 aa AA seqDB search
MSFNFVHDSKFTSPTHNLSEMSSLTRSQLGQVQTSFPSQTQPVPIPMSATSASTGTSNSQ
QGSPIMSPDTAVLTTYSSVQASPEPMRGREEEAFPSSFQLPESVLSRKTSTNSLGYNAMS
EVANNSKGGLIRRFSNRAQRFAGRRRPSSGAPASRDGSVGPSILRRRSDSNATAPQENSA
LTDTDEEFVPDDSMSMVGVDGANYTSSANSTHGSISASAGAMAGPVLPAELRNGCPVKKV
SKKSRPKRITLAYETESNKLSWDPSRPQKSLHVDEIREIRTGTDIQQYIHDYGLSEQIEF
YFPVWFTIIYNVPESSKTRFLHIVTDNSNTLSLWTEFLDAMLRYRQQLMTSLMSFNDRAV
AQYWQTEMAKEFGDQARTPDQEEMNIAGVKRVCQNLHIYSSSSTLEVNFHLSDSRRRSKL
NFREFKDFVRRMKQRNDVQRVIRNIAANPEFGLTLSEFLTFLRDDQGEDVDSNRTAWEKL
FSRFCRQYRSTEADLPENVEIMTEAAFVAFLTSEDNEVIQPEPQNIVLDRPMNEYYISSS
HNTYLLGRQVAGQSSVEGYISALARGCRCVEVDCWDGYNGQPEVNHGRTMTTSISFKEVM
TTINKYAFVKSKFPLWISLEVHCSPAQQATMVEIIKESFGSRLVTETLEAFPDKLPTPSE
LMERVLIKVKKPQIKEEPIAAGNDFRGRRRGNSLNSPMMRPSVPDGTPLMPSQSLPQSPM
LTPSHSSRRLVSKTRVNTITEGQVQGMLSSSTSDNESVSEQPVKKVHNKTVKVLGDLGVY
CAGVKFSGFDTVDAKQYNHIFSFMESSFAKHSRAKDQKMALDIHNMRYMMRVYPDRTRIT
SNNFDPLNYWRRGVQMAALNWQTFDLGMQLNRAMFDGKDSSGYVLKPAELRDIQVLPYNA
DIAEGKKERTVISFTIDVISAQQLMRPANLPANKSMDPYVEVEVFHANDKRDKKEADSNL
VLEHDTPLKYQTDVIRENGFNPLFDRTMKYTVTTKHPDLIFVRWSVKLSNDGESYNERPA
VATYTAKLTNLKQGYRTLPLLNHAGDQYLFSKLFCKIKIDSVEKKFMEAPRRVQDGNKLN
RLGGKVFSRMNTSPKSTIEKSSSEKTSFDSY
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaactttgtccacgattcaaaattcacatcaccaactcacaacttatccgaa
atgtcctcattaacacgctctcaacttggtcaggtccagacatcctttccatcacaaaca
caaccagtccctattcccatgtcagctacaagtgcttcaacaggaacatcaaactcacaa
caaggctcaccaatcatgtcgcccgacactgctgttctaaccacatactcctccgtccag
gcctcacctgagcccatgcgaggtcgggaggaggaggctttcccttctagctttcagttg
cctgagtctgtgctctccaggaagacaagcaccaactctctcgggtataatgccatgtcc
gaagtggccaacaacagcaagggaggtcttatccgccgattctcgaaccgagctcaacgc
tttgccggcagaagacgaccatcttcaggcgctcctgccagccgcgatggaagcgttggc
cctagcatcctcagacgtcgcagcgacagcaatgctacagcaccacaagagaacagcgcc
ctgacagacacggatgaggagtttgttcctgacgactccatgtctatggttggtgttgac
ggcgctaactacacatcatccgccaacagcacccatggctcaatcagtgcaagtgctgga
gctatggctggcccagtgctccctgccgagctacgcaatgggtgcccggtgaagaaggtg
tccaagaaaagtcgaccaaagaggatcacccttgcttacgagactgagtctaataaactc
tcttgggatccaagccgtcctcaaaaatctcttcacgtcgacgaaattagggagatccga
acaggcaccgacatccagcagtacatccacgactatgggctttccgaacaaatcgaattc
tactttcctgtttggttcactattatttacaatgtccccgaaagctcaaaaacaagattt
ctacacattgtcaccgataactcaaacaccctatcgctatggaccgagttcctagacgcc
atgttgaggtatcgacagcaacttatgacatcgttgatgtcattcaacgaccgtgctgtt
gcccagtactggcagaccgaaatggccaaagagtttggtgaccaggcccgaacccctgac
caggaggagatgaacattgctggtgtaaagcgtgtttgccagaaccttcacatctacagc
tcatcatcaacccttgaagtcaacttccacttatccgattctcgacgacgatcaaagctc
aactttagagagttcaaggactttgtgcgccgcatgaagcaacgcaacgacgtgcagcga
gttattcgaaacattgctgccaaccctgagtttggtcttactttgtccgagtttcttact
tttctacgcgatgaccagggtgaggatgttgattctaaccgtaccgcttgggagaagctc
ttttctcgattctgccgccaataccgaagtaccgaggccgaccttcctgagaatgttgag
atcatgactgaagccgccttcgttgccttcttgacttcagaagacaacgaggtcatccag
cccgaacctcaaaatattgtcttggaccgcccaatgaatgagtactacatctccagctcc
cacaacacctaccttctcggtcgtcaagtcgctggtcaatcaagcgttgagggttacatc
tcagcgcttgcccgtggttgccgatgtgtcgaggttgattgttgggatggctacaacggc
cagcccgaagtcaaccacggccgtaccatgacaacctcgatcagcttcaaggaggtcatg
accaccatcaacaagtacgcattcgtcaagtccaagttccccctctggatttctctcgag
gtccactgcagcccagcccagcaggcgacaatggttgagatcatcaaggagtccttcggt
tcaaggcttgtcacagagaccctagaagccttccccgacaagcttcccaccccctcagag
cttatggagcgtgtcctcatcaaggtcaagaagcctcagatcaaggaggagcctattgcc
gctggcaatgacttccgtggtcgacgcagaggtaacagcctcaactcgcccatgatgcga
ccttctgttcctgatggcacgcctctcatgccttctcaatctctgccacagagccccatg
cttactcccagccattcatctcgaagattggtcagcaagactcgagtcaataccattact
gagggccaagttcagggcatgctgagcagcagcacaagcgacaacgaaagtgtttctgag
cagccagtcaagaaggtccacaacaagaccgtcaaggttcttggtgacctcggtgtttac
tgtgctggagtcaagttctctggcttcgacactgtcgatgcgaagcagtacaaccatatc
ttctctttcatggagtcgagctttgccaagcactctcgcgctaaggatcagaagatggcc
ctcgatatccacaacatgcgctacatgatgcgagtctaccctgaccgaactcgcatcact
tccaacaacttcgatcctctcaactactggcgtcgcggggttcagatggccgcccttaac
tggcagacttttgaccttggaatgcaactcaaccgcgccatgtttgatggtaaggactct
tccggatatgttctcaagcccgccgaactccgagatatccaggtcctcccatacaacgcc
gacattgctgagggcaagaaggagcgcactgttatctcttttactatcgatgtcatctct
gcccagcagcttatgcgacctgccaacctgcctgcgaacaagtccatggacccctatgtg
gaggttgaggtcttccacgccaacgacaagcgcgacaagaaggaggccgattctaacctg
gtcttggagcatgatacacctctcaagtatcaaaccgatgtcatccgcgagaacggcttc
aaccctctgtttgacaggacgatgaaatacacggtcaccaccaagcaccccgacctgatc
tttgttcgctggtcggtcaagctctccaacgatggcgagagctacaacgagcgcccagcc
gttgccacttataccgccaaactcaccaacctcaagcagggttaccgcaccctgcctctt
cttaaccacgctggcgaccagtatctcttctccaagctcttttgcaagatcaagatcgac
tcggtcgagaagaagtttatggaagcccctcgtcgtgttcaggacggaaacaaactcaac
cgactcggcggcaaggtctttagccgcatgaacaccagccctaaaagcaccatcgaaaag
tctagctccgagaagacgagctttgacagctattga

DBGET integrated database retrieval system