KEGG   Fusarium graminearum: FG05935.1Help
Entry
FG05935.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     FG05935.1
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     FG05935.1
    3.1.1.84  cocaine esterase
     FG05935.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 541 aa AA seqDB search
MASLKLLTTALFAGTSLALPRSQTSNNPTATIDNGVVVGTTTSIPDSKTIVNQFLGIPFG
EKPVRFSPPKPAKEWDTPYDASEYKPSCFMKFNYPEEKRNRTIKTFATPGPPAGTDEDCL
NLNIYTPAGAKTGSKPVAFWIHGGSFSHGSGSLPYYEGSKMAGYEDIVVVTINYRTNIFG
FPATYDLPEGEWNVGFLDQRLALQWVQDNIEAFGGDPEKVTIFGESAGAGSVEDLITAPP
DPLPFRAAILQSGTANTNVTPSGSWDIATKSANCDSDDFEKVLECMREVPATELKDIIER
AELDFQPISDNGTTLANFPRDIRLKSSDKNTIMARVPVMLGSTADEARLEDFMNITIEQA
LRAWMPDVTSAQVSILKIFYPIGSPGINNDFDQVVRIATELGMQCPIRYVAEDFAETGIK
TWRFLYNASFANTEIFKDSGAYHSSEITTLFGTYPEKGATEFQHELSREMQQAWGKFVRD
PENGPGWGQIPKIGVFGGGVSPDSDEKPEKALGVLNTHLLEPRCIAFKGLWTKGKTEEQS
D
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactcaaacttctgactaccgcgctctttgcgggaacatcacttgctcttcct
cgttcacaaacatccaacaatccaacagcaactattgataatggcgtggtagtcggcacc
acaacttccattcccgactccaaaaccattgtcaaccagttcctcggtattccctttggt
gaaaagcccgttcgtttcagtccacccaagccagccaaagaatgggacactccctatgat
gcttctgagtataagccatcatgtttcatgaaattcaactacccagaggagaaacgcaat
cgaactatcaagactttcgctacacctggtcccccagcgggtactgatgaagattgtttg
aatctcaacatttatacacccgctggtgcgaagactggttcaaagcccgttgcattttgg
attcacggtggcagcttcagccatggttctggatcgctgccttactacgaaggatccaaa
atggcgggatatgaggatattgtagtagtcacaatcaactacagaaccaacatttttggt
ttccctgcaacctacgatttgcctgaaggagaatggaatgttggcttcctagaccaacga
ctggccctgcaatgggtccaagataacatcgaagcctttggaggagaccccgaaaaagtc
accatctttggagaaagtgccggcgcaggaagtgttgaggatctcatcactgctcctcct
gatcctctaccttttcgcgcagctatacttcagtccggtacagccaacaccaacgtaaca
cccagcggttcttgggacattgctacgaaatcggcaaactgtgatagtgacgattttgaa
aaggtgcttgagtgtatgcgtgaagttcccgctacagaactcaaggatatcatcgagaga
gctgagcttgattttcaacccatcagtgataatgggacaactcttgcaaacttcccccgc
gatatccgcctcaagtccagcgacaagaataccatcatggcacgtgttcctgtcatgctg
ggctcaaccgctgatgaggcacgattggaagattttatgaacattacgatcgaacaggcc
cttcgagcttggatgccagatgtcacttcagcccaagtctcgattcttaaaatcttctac
cccatcggatctcccggtataaacaatgacttcgaccaagttgtgaggatcgcaaccgaa
ctcggcatgcagtgtccgatccgctatgttgcagaggactttgctgaaacaggcatcaag
acatggagattcttgtacaatgccagctttgcaaacacggagatattcaaggacagtggt
gcttaccactcttctgaaattacaactctcttcggtacatatcccgagaagggtgctacg
gagttccagcatgagttgagtagggagatgcagcaggcttggggcaagtttgttagggat
cccgagaatggaccaggatggggacagattcccaagattggtgtctttgggggcggcgtg
agtcctgattctgatgagaagccagagaaggctttgggggttttgaacacgcatctgctt
gaaccgagatgcattgcattcaagggattatggacaaagggcaagacggaggagcaatca
gactaa

DBGET integrated database retrieval system