KEGG   Fusarium graminearum: FG05956.1Help
Entry
FG05956.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
fgr  Fusarium graminearum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FG05956.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FG05956.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 223 aa AA seqDB search
MRWFLGIAKRNSTLPFKHIPTFQVSKRSFTMASPSDRRPIVISGPSGVGKGTLINMLFTR
HPDQFTLSVSHTTRNPREGESDGVHYHFVTKDAFRDLIAKDGFVEHAQFGSNLYGTSKAT
IEEQTAKGKVVVLDIEMEGVKQVKASTIDARYVFVSPPDTEELEKRLRGRGTETEESIQQ
RLTRAQDELAWARSAEFDKILVNDDLEKTYQELDAFVYTEKSD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggtttttgggtattgcgaagcgcaactcaacccttccttttaagcacataccg
acctttcaagtctcaaaacgctccttcacaatggcttctccttcagaccgtcgacccatc
gttatctcgggacctagcggtgtcggaaagggtacgctgatcaacatgctcttcacccga
caccccgatcagttcactctctccgtgtcgcatactacccgtaaccctcgtgagggcgag
agcgacggtgtccactaccacttcgtcaccaaggatgctttccgggacttgatcgccaag
gacggcttcgtcgagcacgcccaatttggtagcaacctttacggaacgagtaaggcaacc
atcgaggagcaaacagccaagggcaaggtcgtcgtcctcgacatcgaaatggagggcgtc
aagcaagtcaaggcctccaccatcgacgcccgctacgtcttcgtctccccccctgacacc
gaggagctcgagaagagactccgaggccgtggcaccgagaccgaggagagcatccagcag
cgtcttacccgtgcgcaggacgagcttgcctgggcgcgatcagccgagtttgacaagatt
ctcgtcaacgatgatttggagaagacgtaccaggagttggacgcttttgtatacactgag
aagagcgattaa

DBGET integrated database retrieval system