KEGG   Fusarium graminearum: FG06032.1Help
Entry
FG06032.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
fgr  Fusarium graminearum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FG06032.1
   00240 Pyrimidine metabolism
    FG06032.1
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    FG06032.1
   03410 Base excision repair
    FG06032.1
   03420 Nucleotide excision repair
    FG06032.1
   03430 Mismatch repair
    FG06032.1
   03440 Homologous recombination
    FG06032.1
DNA repair and recombination proteins [BR:fgr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      FG06032.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 191 aa AA seqDB search
MPTTRRSAASARSRGLPAKGQSTLSFSNKVTKPVPKNTKKSIISPSVTKIDPSQLAKKKE
TEDIVDDEPAVAELEAAPEPVKSELELQAEKVTDAQIKKYWKSIEKQWSTPRLHQQDVSQ
NERVLRYFDVSSQYGPCIGMPRMKRWKRADRLGLNPPIEVLAVLMNEESKGNDQIETAHM
DEILNSIAVET
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccactcgacgatccgctgccagcgctcgcagcaggggcctgcccgccaaggga
cagtcaactctcagcttctcaaataaagtgacaaagcctgtgccgaagaacactaagaag
tctatcatttcaccttctgttaccaagattgatcccagtcagcttgcaaagaagaaagag
acagaggacattgtcgacgacgagcccgcggttgcggagcttgaggcagccccggagcct
gtcaagtctgagttggagctgcaagcagaaaaggtcacggatgcgcaaatcaaaaagtac
tggaagtccattgagaagcaatggtctactcctcgcctacaccagcaagacgtatcccaa
aatgagagagttcttcgatatttcgacgtgagctcacaatacggtccctgtatcggcatg
cctcgcatgaagcgctggaagcgggcggaccgtctgggccttaaccctcccattgaggtt
ctcgctgttctcatgaatgaagagagcaagggcaacgaccagattgaaacggcacatatg
gacgagatcctcaactccattgccgtggaaacttga

DBGET integrated database retrieval system