KEGG   Fusarium graminearum: FG06059.1Help
Entry
FG06059.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
fgr  Fusarium graminearum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fgr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fgr00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 340 aa AA seqDB search
MADSSISFLPLGAIIQSIVVNGVNIVQGFPTQEDYEKYNYPYFGVTVGRIANRIKDARID
SLNGKEVILAANDGKNHLHGGKVGWSTRVWDGPKPVGIREVPGVEGLEGGESVAFTLTSE
DGDEGYPGTVEVTVTYTTGTQKVDGKDVTILAMEYEAKLVGGADETVINMTNHSYFNPSG
KETIADTEMTLPTASYLAVGDDLIPTGKIESFPGVTANKTFTLGPQEPNIDHCFVLNEDP
SSVPLDTRSQPLNLNVKAHHAGSKINLEVYSTEPTFQIYTGAGINVPAVNGLPARKARAG
FCCEPARYVNAANVPEWKNQVLLKKGETYGARTVYKVWSD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggctgactcttccatttctttcctgcccctcggcgccatcattcagtccattgtcgtc
aacggcgtcaacatcgttcaaggcttccccacccaagaagactatgagaagtacaactat
ccctactttggcgtgaccgttggccgcattgccaaccgtatcaaggacgcccgcatcgac
agccttaatggcaaggaagtcattctcgccgccaacgatggaaagaaccatctccacggt
ggcaaggttggctggagcacccgcgtctgggacggtcccaagcccgttggcatccgtgag
gttcctggtgtcgagggtcttgagggcggggagagcgttgcttttacacttaccagcgag
gatggcgatgagggataccccggtaccgtagaggtcaccgttacttacacgacgggcaca
caaaaggtcgacggcaaggatgtcactattctcgctatggagtacgaggccaagctcgtt
ggcggcgctgatgagacggtcatcaacatgaccaaccactcttacttcaaccccagcgga
aaggagaccattgccgacacagagatgactctccccacagccagctaccttgctgttggc
gacgacctcatccccactggcaagattgagtctttccccggcgtcactgccaacaagacc
ttcactctaggtcctcaagagcccaacatcgaccactgcttcgttctgaacgaggaccct
tcatctgtccctctcgacacccgcagccagcccctcaacctcaacgtcaaggctcaccac
gctggctccaaaatcaaccttgaggtctacagcacagagccaactttccagatctacacc
ggagctggcatcaacgtgcccgccgtcaacggtctgcctgctcgcaaggctcgagctggc
ttctgctgtgagcctgcccgctacgtcaacgcggccaacgtgcccgagtggaagaaccag
gttctgctcaagaagggagagacatacggcgccagaacagtttacaaggtgtggtccgac
taa

DBGET integrated database retrieval system