KEGG   Fusarium graminearum: FG06085.1Help
Entry
FG06085.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
fgr  Fusarium graminearum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1492 aa AA seqDB search
MAAQDNDTYGTLPGTELPNVSQNWTHFKGRIYDKSLEGCHPSRWIFELLNNKFTTCDIFQ
RAQQAELDVPYPWQDHAHRLIINGNQSYFTSETRILSSVCIDCHFHFVFKLSWQKDHIDE
LCNPRQSQWPPRDGRFPWHHLAWAGSETAMDFRPERHKYNPLVARENFACSAAPCTFQVT
LDISKPRMPLWWINLLLDADTIREELRIAKENDPERYMAATDDWAMQAPLNLNTYLKNLI
EATSQEGARSISKRNKRFAVLFGPRCFRIFRELEFEETVDIREDDVDEGAFKPVVPPPPD
APSGSTRIGTYRGYIEDVRAEVQCLIHKRGEPAELCTPSLHAYLGCSEVPDVSSNVFVLI
ARYKLMGVLPNQPKEIVDNAYRRQWDLLPPHRRRDLIDALGQIANDLNDEDFSHYAIMQS
SVYESQAPAQTNDEDTELTNQALLFFGLQPPNNHDPESIVLAFRRKVSQDPSDAASARNM
LMLISNAANDEAYKNLLMAEFVEGFSLTTAKEILGLSDASFDSDTLDSIKNKIQNAKDKD
AKTTYLDAMERIAEYTNSTDLKGIVAELRQQNDISASTGVVTSSSSDQAADYDLPVGLEN
IGNTCYLNSLLQYLFTVKPVRDIAVNYNEFKLELTDDMIEGRLLGGNKMRMKREVAQELS
ELFNKLETSNTRATKPSQRLANAVLLDTDTLVKAANTSAETGVANQPPPLPTRPPPGPPA
KDLDDVEMSNVTVKNDPDPADAASTASSQTLVEDSDRSYDKVEALPTTNDDQITDTVMEV
GQDDDDVVEVSRPNHQAGGVIEVSEKENNGASPDTNMIDVEDPQTIDQKVLTALEHQERS
SGTDQQDVEEVMGNIISRLQAAIRPSFINDVTGIQMEPIMETFFVTTINYTKKFDESVYQ
KEISFDRFITAFPSPQGGTCSLYDALGRNFDQQAIEGSQQSRYTAIKTLPPVLHVLIQRS
QSVNGKNDNPVEIPETLYLDRYMDAPHDSATFRDREKSWATANRISEIVASLAAAGSTGP
TGPFLESFLQEGKADDSNTTTTDDATMADSEEAGEESWDFDGPVDDDFLVVNRPSKPAAS
AVEQPEMPQSIKTTESAIRERMESELRETTEDLEKYYAGLKNNPYRLHAVICHRGSLRSG
HYWVWIYDFAQNVWRKYNDSNVEVKTSTGEVLRTLSSSGEPYFLCYVRDEDKEAYVDVPR
RRRPRPLPSSDDELQPKDADGDTERRLSDTDCDAELTRQLQHREIMEVKDDPDEDSIAHV
PDFDEDAFLDDIPDIVSVPGSDSDAPKEWVSDEETISVSPSGVKRRTTMIRPKPKFKQRR
LSFDDLATINGLAKTFRDTTNSIMDNIAKGEDNEDNVLTLFTDIINFTSRYSVQYGGDKR
ITTLVGLANDILETTNNEENGVYKTPTKLIHMARQNLNSLTGFVHKTGEDENPPAVHIPQ
QQSPDDRTSLQYFLNKHMSDVKHQTSENENTTLKRGKLRGMVDYVREANQKS
NT seq 4479 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccaggataatgatacgtatggaacattgcctggcacagagctccccaatgta
tcacaaaactggacgcatttcaaaggccggatatacgacaagtccttggaaggatgccac
ccttcaagatggatattcgaacttctgaacaacaaattcacaacatgcgacatcttccaa
cgagcacaacaagccgagctggacgttccttatccatggcaagatcacgcccatcgactg
atcataaatggcaaccagagctacttcacctccgaaacacgcatcctgtcatcagtgtgt
attgattgccatttccattttgtcttcaaactgtcttggcagaaggatcacatagacgag
ctctgcaatcctcgccaatcacaatggcctccaagagatggcagattcccctggcatcat
ctggcatgggctggctcagaaaccgcaatggattttcgccctgaacgacacaaatacaac
cctcttgttgcgcgcgagaattttgcttgctcggcagccccgtgcacattccaagtcacc
cttgatatctcgaagcctcgcatgcctttgtggtggatcaacctgttgctcgacgctgat
acgatccgtgaagagttgcgcatcgccaaggagaatgacccggaacgatacatggcggcg
actgatgattgggcgatgcaagcccctctgaatctcaacacctacctcaagaacttgata
gaggcaacgtctcaggaaggtgctagaagtatttcaaagcgtaacaagcgattcgctgtc
ctgttcggtccccgttgctttaggatatttcgagagctcgagttcgaggaaacagtcgac
attagggaagatgatgtggatgaaggagcgtttaagcctgtggtcccccctccacctgac
gcaccttccggttctacccggataggaacatatcgcggatacatcgaggacgttagagct
gaagtgcagtgcttgattcacaaacggggcgaacctgcagagctctgcactcccagccta
cacgcctacctaggttgctcagaggtcccggatgtcagctccaatgtatttgtcctcatc
gcccgttacaagttgatgggtgttttaccaaaccaacccaaggaaattgtggacaatgct
tacagaagacaatgggatttgttgccgcctcacagaagaagagatctgatagacgctctc
gggcaaattgcgaacgacctaaatgacgaggacttcagccactacgccatcatgcaatcc
tcagtttacgaaagtcaggctccagcacaaaccaatgatgaggatacggaattgacaaac
caagcgttgcttttcttcggactgcaaccaccaaataaccatgatcctgaatcaatagtg
ctggcgtttcggcgcaaggtgtcacaagatcccagtgatgctgcttctgcacgaaatatg
ttgatgttgatttccaatgcggccaatgacgaggcctacaagaaccttttaatggcagag
ttcgttgaaggattttccctaacgaccgccaaagagattctcgggttgagcgatgcaagc
ttcgactctgatactctcgacagcatcaagaacaagattcaaaatgccaaggacaaggat
gcaaagacaacctacctggacgcaatggaaagaattgccgagtataccaattctacagat
cttaaaggtatcgttgccgagttgcgacaacaaaacgacatttcagcctctactggtgta
gtcacttccagtagttcagaccaagctgccgactatgatcttccggttggactagagaat
attggaaacacatgttacttgaacagccttttgcaatacctctttactgtcaagccagta
cgagacatcgctgtcaattataatgagttcaagctggagttgactgatgacatgatcgag
ggccgactgcttggtggcaacaagatgcgtatgaagcgagaagttgcccaagagctctca
gagctgttcaacaagcttgaaacctcaaacaccagagcaacgaaaccctcacagagatta
gccaatgccgtccttctcgacactgacacccttgtcaaagctgccaacacttccgctgaa
acgggcgtcgcaaaccaaccgccaccgctccccacacggccacccccaggtcccccagct
aaggacttggatgatgtggaaatgtctaatgtgaccgtcaaaaacgacccagacccggct
gatgcagctagtactgccagttcgcagacacttgtcgaggattctgatcgttcctatgac
aaagtcgaagccttgcctaccaccaacgatgatcaaattactgataccgttatggaagtc
ggtcaagatgacgatgatgtcgttgaagtcagccgaccaaaccaccaagccggtggggtt
atcgaagtttccgaaaaggagaataatggtgcttctcctgataccaatatgatagatgtt
gaggatccccaaacaattgaccagaaggttctgacagccctggagcaccaggagagatcc
tctggtacagatcagcaggatgttgaggaagttatgggcaatatcatcagtcgcctccaa
gccgccatacgaccatcctttatcaacgacgttacagggatccaaatggaacctattatg
gaaaccttcttcgttacaacgatcaattacaccaaaaagtttgacgagagcgtttatcag
aaggaaatcagtttcgaccggtttatcacagcttttccttctccacagggaggaacatgc
tcactgtatgatgcactcggtcgtaactttgatcagcaggctatagagggaagccagcag
tcacgatatacagctatcaagacactgccgcctgtcctgcacgttctgatccagcgctca
caatccgtgaatggcaagaacgataatccggttgagattcccgagacgctgtaccttgac
cggtatatggacgccccccatgactcggcaacgttccgagaccgagaaaaaagctgggcg
actgctaatcgcatatctgagatcgtggcttccttggctgccgcaggaagcactggtcca
actggtcccttcctggagtcatttctgcaagaaggaaaagcagatgacagtaatacaact
accacagacgatgctacgatggcagatagtgaggaggctggggaagagtcctgggacttt
gatggcccagtagatgatgacttcctggtggtcaatcggcccagtaaacccgcagcttct
gcagttgagcagcccgagatgccgcagagtatcaaaacaaccgaatctgccattcgagag
agaatggaatcggagctgagagagacaacagaggacctcgagaagtactatgccgggctc
aagaacaatccttaccgcctccatgctgtcatttgtcacagaggtagtctcaggtctggg
cactactgggtgtggatttatgactttgcacaaaatgtatggcgcaaatacaacgactcg
aacgttgaggtcaaaacaagtacgggcgaagttctgagaacattaagctccagtggcgag
ccttacttcctttgctacgtccgtgatgaggacaaggaggcgtacgttgatgtaccgcga
cgtcgaagaccgagaccgttaccatcttcagacgacgagttgcagcctaaagatgccgat
ggagacacagagcgacgattgtccgacactgattgcgatgccgagcttacgaggcaactt
caacatcgagagatcatggaagtcaaggatgatcctgatgaagattccatcgcgcacgtc
cctgatttcgatgaagatgccttcttggacgatatccctgatatcgtctcggttcctggt
agcgattctgatgctcctaaggaatgggtatcagatgaagaaacgatcagtgtttctccg
tcgggggtaaagcgaagaacaacgatgatcagaccaaaacccaagttcaaacaaaggcgt
ctttcctttgatgaccttgcaacgatcaatggtttggccaagacttttcgcgacaccacg
aacagtatcatggacaacattgccaagggtgaagacaacgaagacaacgttcttacatta
ttcacggatattatcaacttcacgagtagatacagcgtccaatatggcggagacaaaaga
atcacaacactcgttggtttagccaatgatatcctcgagaccaccaacaacgaggaaaat
ggcgtatacaagacccccacaaagctcattcatatggcgaggcaaaaccttaatagcctg
actggtttcgtccataaaactggtgaggacgaaaaccctccagctgtccatatacctcaa
caacaatctcccgacgatcgaacttcgctacagtattttctcaacaaacacatgagtgat
gtgaagcatcaaactagcgaaaacgagaacaccactctaaaacgcggcaagcttcggggg
atggttgattatgtcagagaagcaaaccagaagtcatga

DBGET integrated database retrieval system