KEGG   Fusarium graminearum: FG06107.1Help
Entry
FG06107.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     FG06107.1
Peptidases [BR:fgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   FG06107.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 706 aa AA seqDB search
MTSQHSDFDAFYDDQVAAHRRFLSPQNPWDRITQPSVLISCFIVVITLSYNLYASTTTLQ
ESIRLLGTSLWDGLVFVVPERLLDAIDTPDTSTTTTSLPMLRAERSRHDVKSDKMRRVLG
LDRSGGVMSSVLQVRSRALSLTGSVLGLKGEPFCPPGLGNMDNSCYQNSILQGLSSLKPL
PEYLSAYLEASDDSGDQDVAQTLRTLIADLNDGTNYGRTLWTPGVLKSMSTWTQQDAQEY
YSKILDDIDKSVAKAVKSAQPQHPGLAVKMDKDDTTASEHSDDSGYQSMINYSENNLPHN
PLEGMLAQRVACVQCGHSDGLSMIPFTCLTLSLGLNKNQHDLYERLDAYSKVEAIENVEC
TKCTLVRTQQQLSAMSKKMQENGSPNEKVLEHLNQRLEAVELALEEDDFDDKTLTEKCKI
SAQNKVSSTKTKQIVISRPPKSLAIHMQRSVFDPSTFNMMKNSAPVDFPMTLDLAPWCLG
STGSNPLDEKSRLEEEWVTDPRKSMVAGDQGSSKLAGPIYELRAVVTHYGRHENGHYICY
RKYPRRSPPTKVAEDDVPDNKAGAQSETSTDEKERDEPEMDWWRLSDHNVSQVSEDVVLS
LSPGVFMLFYDCVDPSMVMNDEDDVNMQDANEVADVDAANRLVGATGNAAPIGQGLESQK
ANRTPKEPSGYEEGATSYSSNGQTDETITRGSDLATNAPSLIRAGS
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctcaacattctgatttcgacgccttctacgacgaccaggtcgcagctcatcga
cggttcctttcaccacagaatccctgggatcgcatcacacaaccgagtgttctgatatcc
tgctttatcgtcgtcatcaccctttcatacaacttatatgcttccaccaccactctccag
gagtcaatacgcttattgggaacaagtctctgggacggtctcgtatttgttgtcccagag
agactcttggatgcgatagatacacccgatacctccacgaccacaacctccttaccaatg
ctacgcgccgaacgaagccgacacgatgttaagagcgacaagatgcgaagggtcctgggg
ctggaccgctctggtggtgtcatgtcctcagtcctccaggtcaggagtcgcgccctttct
ctaacaggtagtgttctgggattgaagggcgaacctttctgcccaccaggcctcggtaat
atggacaactcatgctaccaaaatagcatcctccagggactttcatctctcaaacctctc
cctgaatacctctccgcgtacctcgaagcgtccgacgacagcggcgaccaggatgttgca
caaacattacgaacattgatcgccgatctcaacgacggcacgaattacggacgaacatta
tggacacctggcgtactcaagtccatgagcacctggacacaacaagatgctcaagaatac
tattctaaaatactggacgacattgataaaagtgttgccaaagctgtcaaaagcgcgcag
cctcagcaccccggccttgcggttaagatggataaggacgatacaactgcgagtgagcac
agcgacgacagtggttatcaaagtatgattaattattccgaaaacaatttacctcataac
ccactggagggcatgctcgcgcaaagagtcgcctgtgtccagtgtggtcattctgatgga
ctatcgatgatccctttcacatgcttgacgctaagtctggggttgaacaagaatcagcac
gacctgtatgaacggttggatgcgtacagcaaggtggaggcgattgagaatgtcgagtgc
accaaatgtacactggtcaggactcagcaacaactatcggccatgtcaaagaaaatgcag
gaaaacgggtcacccaacgagaaagttctagagcatctaaaccagcgattggaggcggtc
gagctcgccttggaagaagatgactttgacgacaagacattgaccgaaaagtgtaagatc
tcggctcagaacaaagtcagttcgacaaagactaagcagattgtcatctctcgaccacca
aagagtttggcgattcacatgcaacgatcggtgtttgacccctccaccttcaatatgatg
aagaactcagcgccagtcgatttccctatgacgctagatcttgcaccttggtgcttgggt
agtactggctcgaatccattggacgaaaagtcgaggctggaagaagaatgggttactgac
cctcgaaaatcgatggtagccggcgatcagggttcaagcaagcttgcaggacccatttac
gagcttcgtgcggtggtgacacattatgggcgacacgagaatggccactatatctgttat
cgcaagtacccacgacgtagccctcctaccaaggtagctgaggatgacgtgcctgacaat
aaggctggtgctcagtcggaaaccagtacggatgagaaagaaagggacgagcccgaaatg
gattggtggcgtttgagcgatcacaatgtctcccaagtcagcgaggatgttgtcttgagt
ctttcccctggcgttttcatgctcttctacgattgcgtagaccctagcatggtcatgaat
gatgaagacgacgtcaacatgcaagatgcaaatgaagtcgcggacgtagatgccgcaaac
aggctggtcggtgccacgggaaatgcggccccaatcggccaggggctcgaaagccaaaag
gctaataggacgccaaaggagccatctggatatgaagaaggtgccacgtcatacagctca
aatggccaaactgatgaaaccataacgcgcggctcagatttggctactaacgcgccttca
ctgattcgtgctgggtcatga

DBGET integrated database retrieval system