KEGG   Fusarium graminearum: FG06114.1Help
Entry
FG06114.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
fgr  Fusarium graminearum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fgr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 625 aa AA seqDB search
MAVQTKAAKLSSFALRISALVFFRLFPAHFGFAAFTLFAIYVPSYIASYYTKPKVGVLKD
EIDVTVKESVTAETPLLTEDGVAVVPEPKIITDVVDVKEKVVIGEKVPGIISILLSGAPS
AARPIASFLTFLINALLIGLTADALYRARWYYPSDDLSFVRLGYVSPSEAKFVIREPDQV
QMPVIFEYHVKDAESTYDPKMWLTAGFVTSTDNTTDFTTTMTVPLDPAKQMTYEWRTSNN
HTGEFRSAPKAGEMPDTKDGLFTFLSTSCILPRFPYSPLDHALAIPGLKNLANLLPTLDA
QFMLFLGDFIYVDVPERFGKTAEEYRMQYRQIYASPDWAPVAQNLSWIHVLDDHEISNDW
SSNTTGIYSAAVDPWHLYQANVNPPISEAAGPLNLRRNATWYEFTQGPASFFMMDTRSYR
SSNNAPFNATDKTMLGKEQLADLLAWLARPVPKGVRWKFIASSVPFTKNWPINVKDTWGG
FLTERKQILEAMWDSGARGTSVVILSGDRHEFAATRFPPPVDSQWPQSAAAHEFSTSPLN
QFASPFPTYKQTDDEDVMMSYIPGGKSKFGSFSIGKLEDNRSSLYYTLYIDGKETWKATV
QAPDSPEDVIQEVVPPSFWDKIKFF
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcagacgaaagctgcaaagctatcctcatttgctttgaggataagcgctcta
gtattcttcagacttttccctgcacactttggcttcgccgcctttactctcttcgccatc
tatgttccatcttatattgcgagctactacactaagcctaaagttggtgtcctcaaagat
gagattgatgttactgtgaaggagtccgtcacagctgaaacccctctcttgactgaagat
ggcgtcgccgtcgtgcctgagcccaagatcattaccgatgtagttgatgtcaaggagaag
gtcgtgatcggtgaaaaggttcccggtatcatcagcattctcttgtctggagctcccagc
gctgcgcgtccaattgcgagtttcctaaccttcctcatcaacgctcttctcatcggcttg
actgctgatgctctataccgtgctcgatggtactacccctctgacgacctgtcttttgtt
cgactgggctatgtatcgccatctgaggcgaagttcgtcattcgtgagcctgatcaggtc
cagatgcctgtcatattcgagtaccacgttaaggatgccgagtccacttacgaccccaag
atgtggctcactgcaggctttgtcacttccactgacaacaccaccgacttcaccacgact
atgacggtacctctggaccctgcaaagcagatgacctacgaatggaggacttctaacaat
cacacgggcgaatttcgctccgctcccaaggcaggagagatgcccgacaccaaggatggc
cttttcactttcctctccacttcgtgcattcttcctcgcttcccttacagcccactggac
catgctttggccatccctggtctgaagaaccttgccaacctgttgcctactctggatgcc
caattcatgctgttccttggtgactttatctacgtcgatgttcccgagcgatttggaaag
accgcagaagaatatcgtatgcaatatcgacagatctatgcttcacccgactgggcccct
gttgctcaaaacctcagctggatccacgttctcgatgatcacgagatctcaaacgattgg
tcttccaacacaactggtatctacagcgctgctgtggacccttggcacctttaccaagct
aatgtcaaccctcctatctctgaagccgctggtcccctcaatctcagacgcaatgccacc
tggtacgagttcactcaaggaccagccagctttttcatgatggatactcgcagctaccgc
tccagcaacaacgcgccattcaacgctacagataagaccatgctgggcaaggagcaactg
gctgatctgctggcctggctcgcccgtcctgttcccaagggtgttcgatggaagttcatt
gcttcttctgtccctttcaccaagaactggcccatcaatgtcaaggacacctggggtggt
ttcctcactgagagaaagcaaatccttgaggctatgtgggactccggtgcacgaggtacc
agcgtcgttattctctccggcgatcgccatgagtttgccgctaccaggttcccacctcct
gttgactcgcaatggccacagtccgctgctgcccacgaattctctaccagccccttgaac
cagtttgcttctcctttccccacatacaagcagacagacgatgaggatgttatgatgagc
tatattcccggaggcaagtctaagtttggttctttctcgattggcaagctcgaggacaac
aggagttcgctctactataccctctacattgacggtaaggagacgtggaaggcgactgtc
caggctccggactcgcccgaggacgttattcaagaggttgttcccccctcattctgggac
aagatcaagttcttctag

DBGET integrated database retrieval system