KEGG   Fusarium graminearum: FG06150.1Help
Entry
FG06150.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fgr  Fusarium graminearum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    FG06150.1
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FG06150.1
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FG06150.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 171 aa AA seqDB search
MASATSFYDFKPLDKRGQEVPLADYKGKVVLIVNTASKCGFTPQYAGLEKLWTDLKGKYP
DDFVILGFPCNQFGGQEPGTDDDIQEFCQLNYGVTFPIMQKTEVNGDGTNPLWVWLKDQQ
SGLLGLKRIKWNFEKFLVGRDGKVKGRWASTTKPESLEKPILEALAEKPAA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgctactagcttttacgactttaagccgcttgacaagcgcggccaggaggtt
cccctcgccgactacaagggcaaggtcgtcctcattgtcaacactgcctccaagtgcggc
ttcacccctcagtacgccggtcttgagaagctctggaccgacctcaagggcaagtacccc
gatgactttgtcatcctcggcttcccctgcaatcagttcggcggccaggagcccggcacc
gacgatgacattcaggagttctgccagctcaactacggcgtgaccttccccatcatgcaa
aagaccgaggtcaacggtgacggcaccaaccctctctgggtctggctcaaggaccagcag
tccggtcttctcggcctcaagcgcatcaagtggaactttgagaagttcctcgtcggccgt
gatggaaaggtcaagggtcgatgggccagcaccaccaagcctgagagtcttgagaagccc
attctcgaggcccttgctgagaagcctgcggcttaa

DBGET integrated database retrieval system