KEGG   Fusarium graminearum: FG06150.1Help
Entry
FG06150.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fgr  Fusarium graminearum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:fgr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:fgr00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 171 aa AA seqDB search
MASATSFYDFKPLDKRGQEVPLADYKGKVVLIVNTASKCGFTPQYAGLEKLWTDLKGKYP
DDFVILGFPCNQFGGQEPGTDDDIQEFCQLNYGVTFPIMQKTEVNGDGTNPLWVWLKDQQ
SGLLGLKRIKWNFEKFLVGRDGKVKGRWASTTKPESLEKPILEALAEKPAA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgctactagcttttacgactttaagccgcttgacaagcgcggccaggaggtt
cccctcgccgactacaagggcaaggtcgtcctcattgtcaacactgcctccaagtgcggc
ttcacccctcagtacgccggtcttgagaagctctggaccgacctcaagggcaagtacccc
gatgactttgtcatcctcggcttcccctgcaatcagttcggcggccaggagcccggcacc
gacgatgacattcaggagttctgccagctcaactacggcgtgaccttccccatcatgcaa
aagaccgaggtcaacggtgacggcaccaaccctctctgggtctggctcaaggaccagcag
tccggtcttctcggcctcaagcgcatcaagtggaactttgagaagttcctcgtcggccgt
gatggaaaggtcaagggtcgatgggccagcaccaccaagcctgagagtcttgagaagccc
attctcgaggcccttgctgagaagcctgcggcttaa

DBGET integrated database retrieval system