KEGG   Fusarium graminearum: FG06362.1Help
Entry
FG06362.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     FG06362.1
Peptidases [BR:fgr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   FG06362.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 477 aa AA seqDB search
MEHGTQADGGIQTDENTPIAPSLRRSNRLASKPPQQIKAIVAMSEPRRNPKRKACEPANE
VNQRINSDELLNEALAPLSQEDIEEWEGWIELESEPAFFTIILRDLGVQNVKAQEIFTID
QDSLSHLPQPVYGLIFLFQYLPGMEETNEEQDASDVWFANQTTNNACATVAMLNIVMNAE
GIELGDKLQAFKESTKNLSTALRGHQISKNRFIRTIHNSFTRRMDHLNADLFLENESSEA
KSSANKRRSAPKGGKRAPPRKKKTDSDYGFHFIAYVPAGGYVWELDGLQYKPYRLDPVPS
SSKWTSVAAPQIEARMLQYEESQLSFNLLALCQSPLAAYSRTIARAAASLQFVCTNTNLP
EFEMLIRGEKLPLDVDDESQLSEFNITKSDITNAQIPYAIQYKLKRPGFDTQTAYELYQE
LIIDLKAAMGEFHAEMTAISDDEQRVKGRKKDYGPALHKWMTKLAQKGVLEEVIKTT
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggagcacgggacacaagctgacggcggcatccagactgatgagaatacgcccatcgcg
ccttcgctgcgtcgttcgaatcgtctagcttctaaacctcctcagcaaatcaaggccata
gtcgctatgagcgagccgagacgaaaccccaagcgcaaggcctgtgagccagcgaatgag
gtaaatcagcgtatcaactcagacgaactcctgaatgaggctctggccccgctatctcaa
gaggatatcgaggagtgggaaggttggatagagcttgagtcagaaccagctttcttcacc
atcatacttcgagaccttggtgttcagaatgtgaaggcgcaggaaatattcaccattgac
caagactctctttcacaccttccgcagccagtatacggcttgatcttcctcttccagtat
cttcctggaatggaggaaacgaatgaagaacaagatgcaagcgatgtgtggtttgcaaac
cagactacgaacaatgcatgcgctactgttgctatgctcaatattgtcatgaatgctgaa
gggatcgagcttggtgacaaactacaagcgttcaaagagtcgacaaagaacctcagcact
gccctacgtgggcaccaaatcagcaagaatagattcatccgcaccatacacaattctttc
acgcgtcgaatggatcatctgaacgctgacctatttcttgaaaatgaatcatctgaggcg
aagtccagtgcaaacaagagacgttcagcaccgaaaggaggcaaaagagcacctccgcgg
aagaagaaaacagactctgactatggctttcattttatcgcctatgtgcctgcaggaggc
tatgtgtgggagttggatgggcttcagtataagccttacaggctggacccagtgcctagt
tcatccaaatggacatcagtcgcagcgcctcaaattgaggcccgaatgctacagtatgaa
gaaagccagctttcgttcaaccttctagcactctgccaaagccccctagcagcatactcc
cgaaccattgcccgcgccgcagcatctctgcaattcgtatgcaccaacaccaacctcccc
gagtttgaaatgcttatccgtggcgagaaacttcctctcgacgttgacgatgagtctcag
ctatccgaattcaacattaccaaatcagacattaccaatgcacaaatcccctacgccata
caatataagctcaagcgccctggcttcgatactcagactgcttatgagctataccaagaa
cttatcatagacctcaaggcagccatgggcgagtttcacgccgagatgacggccatatcg
gacgatgagcaacgagtcaaggggcgtaagaaagactacggacctgcactacacaagtgg
atgacgaaacttgctcaaaagggggttttggaagaagttatcaaaacaacctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system