KEGG   Fusarium graminearum: FG06387.1Help
Entry
FG06387.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fgr  Fusarium graminearum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FG06387.1
Enzymes [BR:fgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FG06387.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 332 aa AA seqDB search
MTSTDPATEQTSKIPILLLKTRSSPGDSYEDLFSEASANGTGFAPQFVPVLLHQFHGEGM
KEVAALLRERRIGNQEHHEYGGLIFTSQRAVEAFVKLVEDGKAAKTNIVSHATDATTGPS
ETTSWPHLQNVPVYSVGPATTRALAAAPQDPPLQVFGSHTGNGAALAPYILAHYYEWYRD
QARLTLPPLLFLVGETRRDIIPKTLQDGALPDTERIRVNETVVYGTGVMESFPVDLRRVL
GETRDDPVRWIVVFSPTGCDSMLRVMGILDAETNKVYKGYKRDGKTFIATIGPTTRDHLQ
SFGFEPDVCAESPTPRGVLDGIQEFMSKRRQS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacatccaccgatccggctacggagcaaacctccaaaataccaattcttctgctcaag
acaagatcaagtccaggtgattcgtatgaagacctcttctcagaagccagcgccaatgga
actggctttgcgcctcagttcgtcccggtgctattgcatcagttccatggcgagggtatg
aaagaagtggcggcgctacttcgtgagcgtcgcattggaaaccaggaacatcatgaatat
ggcggcttgatctttacgtcgcaacgagcagttgaagcattcgtgaaacttgttgaagat
ggaaaagctgccaagactaatattgtgtctcatgcgacagacgctaccacaggaccctca
gaaacaacatcatggcctcacctccaaaacgttcctgtctacagcgtcggtcctgccacg
acgcgcgccctcgctgccgccccccaggaccctccgctccaagtcttcggcagccacacg
ggcaacggtgccgccctggctccctatatcctcgcccactactatgaatggtaccgtgac
caagcccgtcttaccctcccaccactacttttcttagttggagagacccgccgcgacatc
atccccaagaccctacaggatggtgctctgcctgatactgagcgcatccgtgttaacgag
acggtcgtttacgggacgggcgtcatggagagcttccccgttgatctgcgccgggtcctt
ggtgagacgcgcgatgatccggtccgctggatcgtggtattctctcctacgggatgcgat
agcatgctccgggtcatgggaattttggatgctgagacgaacaaagtatacaaaggatac
aagcgggacggtaagacttttattgcgaccatcggacctaccacaagagatcatctgcag
tcatttggctttgagccagacgtatgcgccgagtcgcccacgccacggggcgtattggac
ggtatacaggagtttatgtccaagaggaggcagagttga

DBGET integrated database retrieval system