KEGG   Fusarium graminearum: FG06387.1Help
Entry
FG06387.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fgr  Fusarium graminearum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fgr00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 332 aa AA seqDB search
MTSTDPATEQTSKIPILLLKTRSSPGDSYEDLFSEASANGTGFAPQFVPVLLHQFHGEGM
KEVAALLRERRIGNQEHHEYGGLIFTSQRAVEAFVKLVEDGKAAKTNIVSHATDATTGPS
ETTSWPHLQNVPVYSVGPATTRALAAAPQDPPLQVFGSHTGNGAALAPYILAHYYEWYRD
QARLTLPPLLFLVGETRRDIIPKTLQDGALPDTERIRVNETVVYGTGVMESFPVDLRRVL
GETRDDPVRWIVVFSPTGCDSMLRVMGILDAETNKVYKGYKRDGKTFIATIGPTTRDHLQ
SFGFEPDVCAESPTPRGVLDGIQEFMSKRRQS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacatccaccgatccggctacggagcaaacctccaaaataccaattcttctgctcaag
acaagatcaagtccaggtgattcgtatgaagacctcttctcagaagccagcgccaatgga
actggctttgcgcctcagttcgtcccggtgctattgcatcagttccatggcgagggtatg
aaagaagtggcggcgctacttcgtgagcgtcgcattggaaaccaggaacatcatgaatat
ggcggcttgatctttacgtcgcaacgagcagttgaagcattcgtgaaacttgttgaagat
ggaaaagctgccaagactaatattgtgtctcatgcgacagacgctaccacaggaccctca
gaaacaacatcatggcctcacctccaaaacgttcctgtctacagcgtcggtcctgccacg
acgcgcgccctcgctgccgccccccaggaccctccgctccaagtcttcggcagccacacg
ggcaacggtgccgccctggctccctatatcctcgcccactactatgaatggtaccgtgac
caagcccgtcttaccctcccaccactacttttcttagttggagagacccgccgcgacatc
atccccaagaccctacaggatggtgctctgcctgatactgagcgcatccgtgttaacgag
acggtcgtttacgggacgggcgtcatggagagcttccccgttgatctgcgccgggtcctt
ggtgagacgcgcgatgatccggtccgctggatcgtggtattctctcctacgggatgcgat
agcatgctccgggtcatgggaattttggatgctgagacgaacaaagtatacaaaggatac
aagcgggacggtaagacttttattgcgaccatcggacctaccacaagagatcatctgcag
tcatttggctttgagccagacgtatgcgccgagtcgcccacgccacggggcgtattggac
ggtatacaggagtttatgtccaagaggaggcagagttga

DBGET integrated database retrieval system