KEGG   Fusarium graminearum: FG06392.1Help
Entry
FG06392.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
fgr  Fusarium graminearum
Brite
Exosome [BR:fgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   FG06392.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 131 aa AA seqDB search
MSWQAYVDSSLVGTGHIDKGAIISAAGDSAWAASADLQLKPEEMKAISAIVSGDEKAKDK
AFAEGLYIAGERYVMARADGRSIYARSGRSGVAVAKTTQAIVVGHHGEAQIAGNATTTVE
SLADYLIKSSY
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaagcatacgtcgactcaagccttgttggcaccggtcacatcgataagggc
gccatcatcagcgccgctggagacagcgcctgggctgcctctgccgacctccagctcaag
cctgaggagatgaaggccatctctgccattgttagcggtgacgaaaaggccaaggacaag
gcttttgccgaaggtctctacatcgccggtgagcgatatgtcatggcccgagctgacggc
cgaagtatctacgctcgatcgggtcgttccggcgtcgctgtcgcaaagaccacccaggcc
atcgtcgtcggccaccacggcgaggcccagatcgccggtaacgccaccaccaccgtcgag
agtcttgccgactacctcatcaagtcgagctactag

DBGET integrated database retrieval system