KEGG   Fusarium graminearum: FG06580.1Help
Entry
FG06580.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
fgr  Fusarium graminearum
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    FG06580.1
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FG06580.1
   00640 Propanoate metabolism
    FG06580.1
  Lipid metabolism
   00061 Fatty acid biosynthesis
    FG06580.1
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    FG06580.1
Enzymes [BR:fgr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     FG06580.1
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     FG06580.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 2271 aa AA seqDB search
MTEISAGAQEGANGRSVPYFNIADHFIGGNRLANAPSGKVKDFVAQNDGHTVITNVLIAN
NGIAAVKEIRSVRKWAYETFRDERAIHFTVMATPEDLQANAEYIRMADHYVEVPGGTNNH
NYANVELIVDIAERMNVHAVWAGWGHASENPKLPESLAASPNKIVFIGPPGSAMRSLGDK
ISSTIVAQHAAVPCIPWSGTGVDQVAVDDKGIVTVADDIYAQGCVTSWEEGLEKAKEIGF
PVMIKASEGGGGKGIRKATEEEGFEALYKAAASEIPGSPIFIMKLAGNARHLEVQLLADQ
YGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFKAMEDAAVRLGKLVGYVSAGTVEYL
YSHSDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDPK
TSSDIDFEFKSEDTSSSQRRPQPKGHTTACRITSEDPGEGFKPSNGVMHELNFRSSSNVW
GYFSVSSQGGIHSFSDSQFGHIFAYGENRSASRKHMVMALKELSIRGDFRTTIEYLIKLL
ETEAFEDNTISTGWLDELISKRLTAERPETMLAVTCGAVTKAHIASEACMTEYRAGLEKG
QVPSKDVLKTVFTIDFIYEGFRYKFTATRASVDSYHLFINGSKCHVGVRSLSDGGILVLL
DGRSHSVYWKEEVGATRLSVDSKTCLLEQENDPTQLRSPSPGKLVKYSVENGAHVRAGQA
FAEVEVMKMYMPLLAQEDGVVQLIKQPGATLEAGDILGILALDDPSRVKQAQAFVDKLPE
YGEPVVVGAKPAQRFSLLYNILHNILLGYDNSVIMDNTLKELIEVLRDTELPYSEWNAQF
SALHSRMPQKLDAQFTQIIERSKSRNADFPAKALSKALHKFIEDNVDAGDAGILKTTLAP
LTEIIDMYIEGQRSRELNVIKSILEQYYEVEALFMNQPQEDAVILQLRDQHKDDIMKVVH
TVLSHSRVSSKSSLILAILEEYRPNKPKAGNVAKSLRETLRLLTELQSRHTSKVSLKARE
IMIQCALPSLEERTSQMEHILRSSVVESRYGETGWDHREPSLDIIKEVVDSKYTVFDVLT
MFFAHDDPWVSLASLEVYVRRAYRAYLLKQIEYHQDENDNPQFVSWDFQLRKLGQSEFGL
PLQSAAPSTPATPSGGEFNFKRIHSISDMSYLNSKWEDEPTRKGVIVPCKYIDEAEDLIG
KALEALAHEQKQKKKNTPGLIPDLSGKRKPAPLKQQEEELSAVINVAIRDVESRDDREAL
EDILPIVEQYKDELLARGVRRLTFICGHSDGSYPGYYTFRGPEYKEDDSIRHSEPALAFQ
LELARLSKFNIKPVFTENKSIHVYEGIGKSVDTDKRYFTRAVIRPGRLRDEIPTAEYLIS
EADRVVNDIFDALEIIGNNNSDLNHVFINFSPVFQLQPKEVEESLQGFLDRFGIRAWRLR
IAQVEIRIICTDPQTGEPYPLRVVITNTSGYVVDVDMYAERKSEKGQWVFHSIGGTHEKG
PMHLMPVSTPYAIKNWLQPKRHDAHGMGTQYVYDFPELFRQAIQNTWNKAVKAQPSLASQ
QPKTGDCISFTELVLDDKDNLDEVNREPGTNTCGMVGWIFRARTPEYPNGRRFIVIANDI
TYKIGSFGPKEDDFFYKCTELARKLGIPRIYLSANSGARLGLADELMGHFKVAWNNPEKQ
DAGFKYLYLDDETKTRFEKDVITEEVTEDGEKRHKIVTVVGKEEGLGVECLRGSGLIAGA
TSRAYNDIFTVTLVTCRSVGIGAYLVRLGQRAVQIEGQPIILTGAAALNNLLGREVYTSN
LQLGGTQIMHRNGVSHMTANDDFAGVSKIVEWMSFVPEKRNSPVPVSPSVDSWDRDVTYY
PPQKQPYDVRWLIGGREGENGFESGLFDKDSFVEALGGWAKTVVVGRARLGGIPMGVIGV
EVRSVENITPADPANPDSIEQVSNEAGGVWYPNSAFKTAQAINDFNNGEQLPLMILANWR
GFSGGQRDMYNEVLKYGSFIVDALVKYEQPIFIYIPPFGELRGGSWVVVDPTINPTAMEM
YADTEARGGVLEPEGMIGIKYRKQKQIQTIIRMDPTYAGLKKQLEDSSLSSEQTDEIKKK
MAAREKELLPVYSQIALQFADLHDRAGRMKAKGAIRDVLEWSSSRRFFYWRLRRRLNEEY
ILRRMTSTIISTSHNQTATKDKETRDKYLHLLRSWSAIVDWEKDDQAVTEWYETERKAIG
EKVDALKSEVLAAEVASVVRGHAKAGWTGVREVMRVMPVEEREQILKYLQQ
NT seq 6816 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatctcagctggtgcccaggagggtgccaatgggcggtcggtgccctatttc
aacatcgcagaccacttcatcggcggcaaccgattggcgaatgctccctcgggcaaggtc
aaggactttgttgcccaaaatgatggtcacactgtcatcacaaacgttctcattgccaac
aacggtatcgctgctgtcaaggagattcgatcggtccgaaaatgggcttacgagacgttt
cgcgatgagcgagccattcacttcactgtgatggccacccccgaagatctgcaggccaac
gcagaatacattcgaatggctgaccactacgtcgaggttcccggcggcaccaacaaccac
aactatgccaatgtcgagctgattgtcgatattgctgagcgtatgaacgttcacgccgtc
tgggctggatggggccacgcctcagaaaaccccaagctgccagagtcgctggccgcttcc
cccaacaagattgtctttatcggaccccctggatctgccatgcgatcattgggtgacaag
atttcctccacaattgttgcacagcacgccgccgtgccctgtattccttggtcaggaaca
ggcgtcgatcaggtcgccgttgacgacaagggtattgttactgttgccgatgatatctac
gcccagggatgcgtcacatcatgggaggagggtctcgagaaggccaaggagattggcttc
cccgtcatgatcaaggcttccgagggtggtggtggcaagggtatccgaaaggctaccgag
gaggagggcttcgaggctctctacaaggctgctgccagtgagattcctggctctcccatc
ttcatcatgaagcttgccggcaacgcccgccatctcgaggtccagcttcttgctgatcag
tacggaaacaacatctccctgttcggtcgtgattgttccgttcagcgacgtcaccagaag
attatcgaagaggctcccgtcaccattgccaagcccgacacattcaaggccatggaggat
gccgctgtccgtctcggtaagctcgtcggttacgtctctgccggtaccgtcgagtacctc
tactcccactccgacgacaagttctacttcctggaactcaacccccgtcttcaggtcgag
catcccactactgagatggtcagtggtgtcaacctgcccgctgcccagcttcagattgcc
atgggtatccctctccacagaatccgtgacattcgactcctgtacggtgtcgaccccaag
acctcaagcgacattgactttgagttcaagagcgaggacacttcctccagccagcgacga
cctcagcccaagggccacaccactgcttgccgaatcacttccgaggatcccggtgagggc
ttcaagccttccaacggtgtcatgcacgagctcaacttcaggagtagctccaacgtttgg
ggttacttctccgtcagttctcagggtggtatccacagtttctctgacagtcagttcggt
cacattttcgcctatggtgagaaccgttctgcttcaaggaagcacatggttatggccctg
aaggagctcagcattcgtggtgatttccgaaccaccattgagtacctcatcaagcttctt
gagacagaggctttcgaggacaacaccatctctactggttggctggacgagctcatctcc
aagcgccttaccgctgagcgacccgagaccatgcttgctgtcacctgtggtgccgttacc
aaggctcacattgccagcgaggcttgcatgaccgagtaccgagccggccttgagaagggt
caggtgccctccaaggacgtgctcaagacggtctttaccatcgacttcatctacgagggt
ttccgttacaagttcacagccactcgtgccagcgtcgacagctaccaccttttcatcaac
ggctccaagtgccatgttggtgttcgttctctgagcgatggtggtatccttgtccttctc
gacggacgaagtcacagcgtctactggaaggaagaggttggtgccactcgtttgtccgtc
gacagcaagacttgcctgctcgagcaggagaacgaccctacccagctccgatctcccagc
cctggtaagcttgtcaagtactccgtcgagaacggtgcccatgtccgcgccggccaggcc
tttgccgaggtcgaggtcatgaagatgtacatgcctctccttgcccaggaggatggtgtt
gtccagctcatcaagcagcccggtgccactctcgaggctggtgatatcctcggtatactc
gctctcgatgaccctagccgcgttaagcaggctcaggctttcgttgacaagcttcccgag
tacggtgagcctgtcgttgtcggtgccaagcccgctcagcgcttctctctcctctacaac
atcctccacaacattcttctgggttacgacaactccgtcatcatggacaacaccctgaag
gagcttatcgaggtcctccgcgataccgagcttccctacagcgagtggaacgcccagttc
tctgccctccactctcgcatgccccagaagcttgatgctcagttcacccagatcattgag
cgcagcaagtctcgcaacgccgacttccctgccaaggctctcagcaaggctcttcacaag
ttcatcgaggacaacgtcgatgctggcgatgccggcattctcaagactaccctcgctccc
ttgaccgagatcatcgacatgtacattgagggccagaggagccgagagctcaacgtcatc
aagagcatcttggagcagtactacgaggtcgaggccctcttcatgaaccagccccaagag
gatgctgttatcttgcagctgcgtgaccagcacaaggatgatatcatgaaggtcgtccac
accgttctgtctcacagccgtgtcagctccaagagctctcttatccttgccattcttgag
gagtatcgacccaacaagcccaaggctggaaacgtcgccaagagcctccgcgagaccctc
cgtctgctcactgagctccagtctcgacacacctccaaggtttccttgaaggcccgtgag
atcatgatccagtgcgctcttccttcccttgaggagcgaacctctcagatggagcacatc
cttcgctcttccgtcgttgagtctcgatacggtgaaactggctgggaccaccgtgagcct
agccttgacatcattaaggaggtcgttgactccaagtacactgtctttgatgtcttgacc
atgttcttcgctcacgatgatccttgggtgtctttggcctctcttgaggtttacgtccgc
cgagcctaccgtgcgtacctcctcaagcagattgagtaccaccaggacgagaacgacaac
cctcaattcgtctcttgggacttccagctccgcaagcttggtcagtccgagtttggtctt
cctctccagtctgctgctccttctacccctgctacacccagcggaggcgagttcaacttt
aagcgaatccactccatcagcgacatgtcctacctcaacagcaagtgggaggatgagcct
actcgcaagggtgtcattgttccttgcaagtacatcgatgaggctgaggatctgattggt
aaggccctcgaggccctcgctcatgagcagaagcagaagaagaagaacactcctggtctt
atccctgacctcagcggcaagcgtaagcctgctcctctcaagcagcaagaggaggagctc
tccgctgttatcaacgttgccatccgtgacgttgagagccgcgacgaccgagaggctctt
gaggatatcctccccattgtcgagcagtacaaggacgagcttcttgcccgtggtgttcgc
cgtctgacattcatctgcggccacagcgatggctcttaccccggatactacactttccgt
ggacccgagtacaaggaggacgacagtatccgccacagcgagcccgcccttgccttccag
cttgagctcgctcgtctcagcaagttcaacatcaagcctgttttcactgagaacaagagt
atccacgtttacgagggtattggcaagagtgttgacactgacaagcgatacttcactcgt
gctgtcattcgacctggtcgtctccgagatgagatccctactgctgagtacctcatttcc
gaggctgaccgtgttgtcaacgatatctttgacgctctcgagattatcggcaacaacaac
tctgatctgaaccacgtcttcatcaacttctctcccgtgttccagcttcagcccaaggag
gttgaagagagtctccagggcttcctcgaccgattcggcatccgtgcttggcgactccgt
atcgctcaggtcgagatccgcatcatctgcaccgacccccagactggcgagccctaccct
ctccgtgtcgtcatcactaacacctctggttacgttgtcgatgtcgatatgtacgccgag
cgcaagtcggagaagggtcaatgggtcttccacagcattggaggcactcacgagaagggt
cccatgcacttgatgcccgtctctaccccttacgccatcaagaactggctccagcccaag
cgtcacgacgctcacggtatgggaactcagtacgtctacgatttccccgagcttttccgc
caggctatccagaacacctggaacaaggccgtcaaggctcagcccagcttggcttctcag
cagcccaagaccggtgactgcatcagcttcaccgagcttgttctagacgacaaggataac
cttgacgaggtgaaccgtgagcctggtaccaacacttgtggtatggttggttggatcttc
agggcccgcacccccgagtaccccaacggccgacgcttcatcgttatcgccaacgatatc
acctacaagattggttcattcggacccaaggaagacgacttcttttacaagtgtactgag
cttgctcgcaagcttggtatccctcgtatctacctatctgccaactctggtgctcgtctt
ggccttgccgatgagctcatgggtcacttcaaggttgcctggaacaaccctgagaagcag
gacgctggcttcaagtacctctaccttgacgacgagaccaagactcgcttcgagaaggat
gtcatcactgaggaggttactgaggatggcgagaagcgacacaagatcgtcactgtcgtt
ggtaaggaggagggtcttggtgttgagtgtctgcgaggctctggtctcatcgctggtgcc
accagccgtgcttacaacgacatctttaccgtcactctggtcacttgccgatccgttggt
attggtgcttaccttgtccgtcttggtcagcgtgctgtccagattgagggccagcccatt
atcctgactggtgctgctgccctcaacaacctgcttggtcgcgaggtttacacctctaac
ctccagcttggtggcacccagatcatgcaccgcaacggtgtttctcacatgaccgccaac
gatgactttgctggtgtgtccaagattgtcgagtggatgtcttttgtgcccgagaagcgc
aacagccccgttcctgtcagccccagcgttgacagctgggaccgtgatgtcacctactac
cctccccagaagcagccctacgatgtccgatggttgatcggtggtcgtgagggcgagaac
ggctttgagtctggtctctttgacaaggactccttcgtcgaggctctcggcggttgggcc
aagactgtcgttgttggtcgtgctcgtctcggtggtatccctatgggtgttatcggtgtc
gaggtccgatccgtggagaacatcactcccgccgaccctgccaaccccgactctatcgag
caggtcagcaatgaggctggtggtgtctggtaccccaactctgccttcaagactgcccag
gctatcaacgacttcaacaacggtgagcagcttcctctgatgatccttgccaactggcgt
ggtttctctggtggtcagcgggacatgtacaacgaggttctcaagtacggttcttttatc
gtcgatgccctcgttaagtacgagcagcccatcttcatctacatccctcccttcggtgag
cttcgtggtggatcttgggtcgtcgtcgatcctaccatcaaccccactgctatggagatg
tacgccgacaccgaggcccgtggtggtgtccttgagcccgagggtatgattggtatcaag
taccgcaagcagaagcagatccagaccatcatccgcatggatcctacttatgctggactc
aagaagcagctcgaggactctagcctgtcttctgagcagaccgacgagattaagaagaag
atggctgcccgcgagaaggagctgttgcctgtctactctcagattgctctccagtttgct
gatctccacgatcgcgctggacgcatgaaggccaagggtgccatccgcgatgttctcgag
tggtccagctcgcgacgcttcttttactggcgtctccgccgccgtctcaacgaggagtac
atcctgcgccgcatgacatccaccatcatcagcacctcgcacaaccagactgctaccaag
gacaaggagactcgcgacaagtacttgcacctcctccgcagctggtcagccattgttgat
tgggagaaggatgaccaggcggtcactgagtggtatgagactgagcgcaaggccatcggt
gagaaggtcgatgccctcaagtctgaggtgctggcagccgaggttgccagcgttgtccga
ggccacgccaaggctggatggactggtgttcgtgaggtgatgagagtcatgcccgttgag
gagcgggagcagattctcaagtacctccagcagtaa

DBGET integrated database retrieval system