KEGG   Fusarium graminearum: FG06580.1Help
Entry
FG06580.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
fgr  Fusarium graminearum
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:fgr01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:fgr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:fgr00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:fgr00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis [PATH:fgr00254]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 2271 aa AA seqDB search
MTEISAGAQEGANGRSVPYFNIADHFIGGNRLANAPSGKVKDFVAQNDGHTVITNVLIAN
NGIAAVKEIRSVRKWAYETFRDERAIHFTVMATPEDLQANAEYIRMADHYVEVPGGTNNH
NYANVELIVDIAERMNVHAVWAGWGHASENPKLPESLAASPNKIVFIGPPGSAMRSLGDK
ISSTIVAQHAAVPCIPWSGTGVDQVAVDDKGIVTVADDIYAQGCVTSWEEGLEKAKEIGF
PVMIKASEGGGGKGIRKATEEEGFEALYKAAASEIPGSPIFIMKLAGNARHLEVQLLADQ
YGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFKAMEDAAVRLGKLVGYVSAGTVEYL
YSHSDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDPK
TSSDIDFEFKSEDTSSSQRRPQPKGHTTACRITSEDPGEGFKPSNGVMHELNFRSSSNVW
GYFSVSSQGGIHSFSDSQFGHIFAYGENRSASRKHMVMALKELSIRGDFRTTIEYLIKLL
ETEAFEDNTISTGWLDELISKRLTAERPETMLAVTCGAVTKAHIASEACMTEYRAGLEKG
QVPSKDVLKTVFTIDFIYEGFRYKFTATRASVDSYHLFINGSKCHVGVRSLSDGGILVLL
DGRSHSVYWKEEVGATRLSVDSKTCLLEQENDPTQLRSPSPGKLVKYSVENGAHVRAGQA
FAEVEVMKMYMPLLAQEDGVVQLIKQPGATLEAGDILGILALDDPSRVKQAQAFVDKLPE
YGEPVVVGAKPAQRFSLLYNILHNILLGYDNSVIMDNTLKELIEVLRDTELPYSEWNAQF
SALHSRMPQKLDAQFTQIIERSKSRNADFPAKALSKALHKFIEDNVDAGDAGILKTTLAP
LTEIIDMYIEGQRSRELNVIKSILEQYYEVEALFMNQPQEDAVILQLRDQHKDDIMKVVH
TVLSHSRVSSKSSLILAILEEYRPNKPKAGNVAKSLRETLRLLTELQSRHTSKVSLKARE
IMIQCALPSLEERTSQMEHILRSSVVESRYGETGWDHREPSLDIIKEVVDSKYTVFDVLT
MFFAHDDPWVSLASLEVYVRRAYRAYLLKQIEYHQDENDNPQFVSWDFQLRKLGQSEFGL
PLQSAAPSTPATPSGGEFNFKRIHSISDMSYLNSKWEDEPTRKGVIVPCKYIDEAEDLIG
KALEALAHEQKQKKKNTPGLIPDLSGKRKPAPLKQQEEELSAVINVAIRDVESRDDREAL
EDILPIVEQYKDELLARGVRRLTFICGHSDGSYPGYYTFRGPEYKEDDSIRHSEPALAFQ
LELARLSKFNIKPVFTENKSIHVYEGIGKSVDTDKRYFTRAVIRPGRLRDEIPTAEYLIS
EADRVVNDIFDALEIIGNNNSDLNHVFINFSPVFQLQPKEVEESLQGFLDRFGIRAWRLR
IAQVEIRIICTDPQTGEPYPLRVVITNTSGYVVDVDMYAERKSEKGQWVFHSIGGTHEKG
PMHLMPVSTPYAIKNWLQPKRHDAHGMGTQYVYDFPELFRQAIQNTWNKAVKAQPSLASQ
QPKTGDCISFTELVLDDKDNLDEVNREPGTNTCGMVGWIFRARTPEYPNGRRFIVIANDI
TYKIGSFGPKEDDFFYKCTELARKLGIPRIYLSANSGARLGLADELMGHFKVAWNNPEKQ
DAGFKYLYLDDETKTRFEKDVITEEVTEDGEKRHKIVTVVGKEEGLGVECLRGSGLIAGA
TSRAYNDIFTVTLVTCRSVGIGAYLVRLGQRAVQIEGQPIILTGAAALNNLLGREVYTSN
LQLGGTQIMHRNGVSHMTANDDFAGVSKIVEWMSFVPEKRNSPVPVSPSVDSWDRDVTYY
PPQKQPYDVRWLIGGREGENGFESGLFDKDSFVEALGGWAKTVVVGRARLGGIPMGVIGV
EVRSVENITPADPANPDSIEQVSNEAGGVWYPNSAFKTAQAINDFNNGEQLPLMILANWR
GFSGGQRDMYNEVLKYGSFIVDALVKYEQPIFIYIPPFGELRGGSWVVVDPTINPTAMEM
YADTEARGGVLEPEGMIGIKYRKQKQIQTIIRMDPTYAGLKKQLEDSSLSSEQTDEIKKK
MAAREKELLPVYSQIALQFADLHDRAGRMKAKGAIRDVLEWSSSRRFFYWRLRRRLNEEY
ILRRMTSTIISTSHNQTATKDKETRDKYLHLLRSWSAIVDWEKDDQAVTEWYETERKAIG
EKVDALKSEVLAAEVASVVRGHAKAGWTGVREVMRVMPVEEREQILKYLQQ
NT seq 6816 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatctcagctggtgcccaggagggtgccaatgggcggtcggtgccctatttc
aacatcgcagaccacttcatcggcggcaaccgattggcgaatgctccctcgggcaaggtc
aaggactttgttgcccaaaatgatggtcacactgtcatcacaaacgttctcattgccaac
aacggtatcgctgctgtcaaggagattcgatcggtccgaaaatgggcttacgagacgttt
cgcgatgagcgagccattcacttcactgtgatggccacccccgaagatctgcaggccaac
gcagaatacattcgaatggctgaccactacgtcgaggttcccggcggcaccaacaaccac
aactatgccaatgtcgagctgattgtcgatattgctgagcgtatgaacgttcacgccgtc
tgggctggatggggccacgcctcagaaaaccccaagctgccagagtcgctggccgcttcc
cccaacaagattgtctttatcggaccccctggatctgccatgcgatcattgggtgacaag
atttcctccacaattgttgcacagcacgccgccgtgccctgtattccttggtcaggaaca
ggcgtcgatcaggtcgccgttgacgacaagggtattgttactgttgccgatgatatctac
gcccagggatgcgtcacatcatgggaggagggtctcgagaaggccaaggagattggcttc
cccgtcatgatcaaggcttccgagggtggtggtggcaagggtatccgaaaggctaccgag
gaggagggcttcgaggctctctacaaggctgctgccagtgagattcctggctctcccatc
ttcatcatgaagcttgccggcaacgcccgccatctcgaggtccagcttcttgctgatcag
tacggaaacaacatctccctgttcggtcgtgattgttccgttcagcgacgtcaccagaag
attatcgaagaggctcccgtcaccattgccaagcccgacacattcaaggccatggaggat
gccgctgtccgtctcggtaagctcgtcggttacgtctctgccggtaccgtcgagtacctc
tactcccactccgacgacaagttctacttcctggaactcaacccccgtcttcaggtcgag
catcccactactgagatggtcagtggtgtcaacctgcccgctgcccagcttcagattgcc
atgggtatccctctccacagaatccgtgacattcgactcctgtacggtgtcgaccccaag
acctcaagcgacattgactttgagttcaagagcgaggacacttcctccagccagcgacga
cctcagcccaagggccacaccactgcttgccgaatcacttccgaggatcccggtgagggc
ttcaagccttccaacggtgtcatgcacgagctcaacttcaggagtagctccaacgtttgg
ggttacttctccgtcagttctcagggtggtatccacagtttctctgacagtcagttcggt
cacattttcgcctatggtgagaaccgttctgcttcaaggaagcacatggttatggccctg
aaggagctcagcattcgtggtgatttccgaaccaccattgagtacctcatcaagcttctt
gagacagaggctttcgaggacaacaccatctctactggttggctggacgagctcatctcc
aagcgccttaccgctgagcgacccgagaccatgcttgctgtcacctgtggtgccgttacc
aaggctcacattgccagcgaggcttgcatgaccgagtaccgagccggccttgagaagggt
caggtgccctccaaggacgtgctcaagacggtctttaccatcgacttcatctacgagggt
ttccgttacaagttcacagccactcgtgccagcgtcgacagctaccaccttttcatcaac
ggctccaagtgccatgttggtgttcgttctctgagcgatggtggtatccttgtccttctc
gacggacgaagtcacagcgtctactggaaggaagaggttggtgccactcgtttgtccgtc
gacagcaagacttgcctgctcgagcaggagaacgaccctacccagctccgatctcccagc
cctggtaagcttgtcaagtactccgtcgagaacggtgcccatgtccgcgccggccaggcc
tttgccgaggtcgaggtcatgaagatgtacatgcctctccttgcccaggaggatggtgtt
gtccagctcatcaagcagcccggtgccactctcgaggctggtgatatcctcggtatactc
gctctcgatgaccctagccgcgttaagcaggctcaggctttcgttgacaagcttcccgag
tacggtgagcctgtcgttgtcggtgccaagcccgctcagcgcttctctctcctctacaac
atcctccacaacattcttctgggttacgacaactccgtcatcatggacaacaccctgaag
gagcttatcgaggtcctccgcgataccgagcttccctacagcgagtggaacgcccagttc
tctgccctccactctcgcatgccccagaagcttgatgctcagttcacccagatcattgag
cgcagcaagtctcgcaacgccgacttccctgccaaggctctcagcaaggctcttcacaag
ttcatcgaggacaacgtcgatgctggcgatgccggcattctcaagactaccctcgctccc
ttgaccgagatcatcgacatgtacattgagggccagaggagccgagagctcaacgtcatc
aagagcatcttggagcagtactacgaggtcgaggccctcttcatgaaccagccccaagag
gatgctgttatcttgcagctgcgtgaccagcacaaggatgatatcatgaaggtcgtccac
accgttctgtctcacagccgtgtcagctccaagagctctcttatccttgccattcttgag
gagtatcgacccaacaagcccaaggctggaaacgtcgccaagagcctccgcgagaccctc
cgtctgctcactgagctccagtctcgacacacctccaaggtttccttgaaggcccgtgag
atcatgatccagtgcgctcttccttcccttgaggagcgaacctctcagatggagcacatc
cttcgctcttccgtcgttgagtctcgatacggtgaaactggctgggaccaccgtgagcct
agccttgacatcattaaggaggtcgttgactccaagtacactgtctttgatgtcttgacc
atgttcttcgctcacgatgatccttgggtgtctttggcctctcttgaggtttacgtccgc
cgagcctaccgtgcgtacctcctcaagcagattgagtaccaccaggacgagaacgacaac
cctcaattcgtctcttgggacttccagctccgcaagcttggtcagtccgagtttggtctt
cctctccagtctgctgctccttctacccctgctacacccagcggaggcgagttcaacttt
aagcgaatccactccatcagcgacatgtcctacctcaacagcaagtgggaggatgagcct
actcgcaagggtgtcattgttccttgcaagtacatcgatgaggctgaggatctgattggt
aaggccctcgaggccctcgctcatgagcagaagcagaagaagaagaacactcctggtctt
atccctgacctcagcggcaagcgtaagcctgctcctctcaagcagcaagaggaggagctc
tccgctgttatcaacgttgccatccgtgacgttgagagccgcgacgaccgagaggctctt
gaggatatcctccccattgtcgagcagtacaaggacgagcttcttgcccgtggtgttcgc
cgtctgacattcatctgcggccacagcgatggctcttaccccggatactacactttccgt
ggacccgagtacaaggaggacgacagtatccgccacagcgagcccgcccttgccttccag
cttgagctcgctcgtctcagcaagttcaacatcaagcctgttttcactgagaacaagagt
atccacgtttacgagggtattggcaagagtgttgacactgacaagcgatacttcactcgt
gctgtcattcgacctggtcgtctccgagatgagatccctactgctgagtacctcatttcc
gaggctgaccgtgttgtcaacgatatctttgacgctctcgagattatcggcaacaacaac
tctgatctgaaccacgtcttcatcaacttctctcccgtgttccagcttcagcccaaggag
gttgaagagagtctccagggcttcctcgaccgattcggcatccgtgcttggcgactccgt
atcgctcaggtcgagatccgcatcatctgcaccgacccccagactggcgagccctaccct
ctccgtgtcgtcatcactaacacctctggttacgttgtcgatgtcgatatgtacgccgag
cgcaagtcggagaagggtcaatgggtcttccacagcattggaggcactcacgagaagggt
cccatgcacttgatgcccgtctctaccccttacgccatcaagaactggctccagcccaag
cgtcacgacgctcacggtatgggaactcagtacgtctacgatttccccgagcttttccgc
caggctatccagaacacctggaacaaggccgtcaaggctcagcccagcttggcttctcag
cagcccaagaccggtgactgcatcagcttcaccgagcttgttctagacgacaaggataac
cttgacgaggtgaaccgtgagcctggtaccaacacttgtggtatggttggttggatcttc
agggcccgcacccccgagtaccccaacggccgacgcttcatcgttatcgccaacgatatc
acctacaagattggttcattcggacccaaggaagacgacttcttttacaagtgtactgag
cttgctcgcaagcttggtatccctcgtatctacctatctgccaactctggtgctcgtctt
ggccttgccgatgagctcatgggtcacttcaaggttgcctggaacaaccctgagaagcag
gacgctggcttcaagtacctctaccttgacgacgagaccaagactcgcttcgagaaggat
gtcatcactgaggaggttactgaggatggcgagaagcgacacaagatcgtcactgtcgtt
ggtaaggaggagggtcttggtgttgagtgtctgcgaggctctggtctcatcgctggtgcc
accagccgtgcttacaacgacatctttaccgtcactctggtcacttgccgatccgttggt
attggtgcttaccttgtccgtcttggtcagcgtgctgtccagattgagggccagcccatt
atcctgactggtgctgctgccctcaacaacctgcttggtcgcgaggtttacacctctaac
ctccagcttggtggcacccagatcatgcaccgcaacggtgtttctcacatgaccgccaac
gatgactttgctggtgtgtccaagattgtcgagtggatgtcttttgtgcccgagaagcgc
aacagccccgttcctgtcagccccagcgttgacagctgggaccgtgatgtcacctactac
cctccccagaagcagccctacgatgtccgatggttgatcggtggtcgtgagggcgagaac
ggctttgagtctggtctctttgacaaggactccttcgtcgaggctctcggcggttgggcc
aagactgtcgttgttggtcgtgctcgtctcggtggtatccctatgggtgttatcggtgtc
gaggtccgatccgtggagaacatcactcccgccgaccctgccaaccccgactctatcgag
caggtcagcaatgaggctggtggtgtctggtaccccaactctgccttcaagactgcccag
gctatcaacgacttcaacaacggtgagcagcttcctctgatgatccttgccaactggcgt
ggtttctctggtggtcagcgggacatgtacaacgaggttctcaagtacggttcttttatc
gtcgatgccctcgttaagtacgagcagcccatcttcatctacatccctcccttcggtgag
cttcgtggtggatcttgggtcgtcgtcgatcctaccatcaaccccactgctatggagatg
tacgccgacaccgaggcccgtggtggtgtccttgagcccgagggtatgattggtatcaag
taccgcaagcagaagcagatccagaccatcatccgcatggatcctacttatgctggactc
aagaagcagctcgaggactctagcctgtcttctgagcagaccgacgagattaagaagaag
atggctgcccgcgagaaggagctgttgcctgtctactctcagattgctctccagtttgct
gatctccacgatcgcgctggacgcatgaaggccaagggtgccatccgcgatgttctcgag
tggtccagctcgcgacgcttcttttactggcgtctccgccgccgtctcaacgaggagtac
atcctgcgccgcatgacatccaccatcatcagcacctcgcacaaccagactgctaccaag
gacaaggagactcgcgacaagtacttgcacctcctccgcagctggtcagccattgttgat
tgggagaaggatgaccaggcggtcactgagtggtatgagactgagcgcaaggccatcggt
gagaaggtcgatgccctcaagtctgaggtgctggcagccgaggttgccagcgttgtccga
ggccacgccaaggctggatggactggtgttcgtgaggtgatgagagtcatgcccgttgag
gagcgggagcagattctcaagtacctccagcagtaa

DBGET integrated database retrieval system