KEGG   Fusarium graminearum: FG06637.1Help
Entry
FG06637.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
fgr  Fusarium graminearum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 702 aa AA seqDB search
MSTPTTATATLPHYHHPHHYPQSYAHSHSHHQPYQPNPSASYRSTASNQNILPPPVSSAV
SPSHSAILPPPYQLSPLAYSSTASNGIGLTHSSTSRSAHHAQEPSPRHDAGYSTATMPET
APASHAEPSRKRRRSREPDWNTFYKNGLPKEIIVIDDTPEPEANTSRKITNSTVVAPNDT
TNRLAAKKRRQNEETGTVQASGYHIKYLESKNNTPVQITTPAGSSNSSSDRTNSGVNTTA
PTSLSSNGQYEDAAAPLKRKRTRQQVANEAKRRDVDGLGDIFTYKPPPYPPKKAGEVNVQ
VIHDRHYNKNVKVDDDDGHYIVIPEAELTDKYQIVRLLGQGTFGKVVEARDRKHNKAVAV
KIIRSVQKYRDASRIELRVLETLKRNDEENRNRCIHLRDCFDYRGHICIVMDLLDQSVFD
FLKGNGFVPFPNSQIQSFARQLFTSVAFLHDLNLIHTDLKPENILLCDHAYQTFTYNRKI
PSSSTTINRQATQRRVLLDTEIRLIDFGSATFQDEYHSSVVSTRHYRAPEIILGLGWSFP
CDIWSIGCILVEFFTGDALFQTHDNLEHLAMMEAVVGSRIDSHLVQAVNKMSNRNGGNAA
SKYFKRLKLDYPTPETTRGSRRFVKAMKHLDHIIPGNNPFLKNFVDLLQKIFVYDPAHRI
TAKQALQHPWLKETAQPDDGTEAAKIRQERIRSEQRNQYVRS
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacctactacggccacggccacgcttccacactaccaccatcctcaccattat
cctcaatcttacgcacattcgcactcgcatcatcagccgtaccagccaaaccccagcgct
tcctatcgttcgactgcttcgaatcagaatattctgcctcctccggtctcttcagctgtc
tcgccctcccacagtgccattctgcctcctccgtaccaactttcgcctttggcatactct
tccacggcatcgaatggcataggcctgacgcactcgtcaacctctcgctctgcacatcac
gcccaggaacccagcccgcgacacgacgcgggttattcaaccgcaaccatgcctgagact
gctcctgcttctcacgcggagccttcgagaaagcgtcgccgttcccgcgaacccgattgg
aatactttttataaaaacggccttcccaaggaaatcattgttattgatgatacgcctgag
cctgaagcgaataccagccggaaaattacaaacagcactgttgtcgcgcccaacgacacc
acgaaccgcctggcggccaagaagaggagacaaaacgaagagactggcactgtacaggcc
tcgggctaccacatcaaatacctcgaatcaaaaaacaataccccggtgcagattacaaca
cccgctggctcctccaattcgagtagtgatcgtaccaattctggtgtcaataccacggcc
ccaacttcactctcgtccaatggtcaatatgaggacgccgcggctccccttaagcgaaag
cgcacccgccagcaggtggctaacgaggccaagcgtcgcgacgttgatggccttggagat
atcttcacatacaagcctccaccttaccctcccaagaaggctggtgaggtaaatgttcag
gttatccatgaccgacattacaacaagaacgtcaaggttgatgacgacgatggtcattac
attgttattcctgaagccgagctcacagataaataccaaatcgtccgcctcttgggccaa
ggaacctttggcaaagttgttgaagcccgcgaccgaaaacacaacaaagctgtggccgtc
aaaatcattcggtcagtccagaaatacagggatgcctccagaattgaacttcgcgttctt
gagaccctcaaacgaaacgacgaggagaaccgtaaccgatgcatccacctccgagactgt
tttgattaccgcggccacatctgtatcgtcatggacttgcttgaccaaagtgtctttgac
tttctcaagggcaacggctttgttccgttccctaacagccagattcaaagcttcgcgcgc
caactcttcaccagcgttgcctttttgcacgatctcaatttaattcatacagatttgaag
cctgagaacatcttgctctgcgaccacgcttatcaaacctttacctataaccgcaagatc
ccatcttcttctaccaccattaaccgccaggccacacaacgccgtgtgctactcgacact
gagattcggttaatcgattttggctctgctacctttcaagacgagtaccactcctcggtg
gtatcgacacgccactatcgagccccggagatcatcctgggtttgggatggtcattcccc
tgcgatatctggagcataggatgcatcttggttgagttctttaccggtgatgctctcttc
cagacgcatgataatctcgaacatctggcaatgatggaggcggtagttggatcacggatc
gacagccatcttgtccaagctgtcaacaagatgtcgaatcgaaatggcggtaatgctgct
tccaaatatttcaaacgcctcaagcttgactatcctacgcccgaaacaactcgtggctcc
cgtcggtttgtcaaggccatgaagcacctcgatcacattattcctggaaataaccctttc
ctcaagaactttgtcgatctgcttcagaagatctttgtgtatgatcctgctcaccgcatc
actgcgaagcaggctctgcaacatccttggctcaaagagacggctcagcccgatgatggt
accgaggctgctaagatccgccaggagaggatacggtcagagcaacggaaccaatatgtc
cgaagttga

DBGET integrated database retrieval system