KEGG   Fusarium graminearum: FG06790.1Help
Entry
FG06790.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
fgr  Fusarium graminearum
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    FG06790.1
Translation factors [BR:fgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    FG06790.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 445 aa AA seqDB search
MHSVLVVDVSDDDFIVSFVDLMRIGCKLTLGPNNCWQREQGGTLPWVSRDNSLMGPWTDL
KAGVGLAQSYTVKVGRVPSIDQEWGFSSELGASQDESRYYVPVTSVLMDTSNLWARRTNP
GKLSLATPGQGSSGDTFSRNASFSKRQGGETPSSMKPNPFNTTPGGLVSPTSGASSAFGL
GSGAFASFGSAKTPKTAGNPFDMAMASATPKKDSAKAVGKASGMAAISESNQSGAPTAPL
SHPLIDSWTFWYRPPISKAHGYIEYEKTLHEIATVRTAEEFWEMYAYLKRPSVLPVVSDF
HLFKKGVRPIWEDDINKKGGKWVVRMKKGVSDRYWEDLLLNLIGDQFGEAGEDVCGAVLS
VRNGEDILSIWTRTDGGRVIKIRETMKHVLNFPPNTRVEFKSHDSSIQQRTAIEESRREK
AGQLHHHDKRHAGGASKQAAEQSQS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcatagtgtgcttgttgtggacgttagtgacgacgattttattgtttcctttgtcgat
ctcatgagaattggttgtaagcttacacttggaccaaataattgctggcaacgggaacaa
gggggcacgctgccctgggtcagtcgcgacaactctctcatgggtccctggactgacctg
aaggctggggttggattagcgcagtcatataccgtcaaggtcgggcgcgtgccttccata
gaccaggaatgggggttttccagcgagttgggtgctagccaagacgagtcgcggtactac
gtacctgttacttcagtcttgatggataccagcaacctctgggcccgccgcacaaacccc
ggcaagctttccctcgcaacaccgggccaagggtccagtggtgacactttcagtcgcaat
gcctctttctccaagcgtcaaggcggcgaaaccccatcatcgatgaaaccgaatcctttc
aacaccacacctggaggtctcgtatcccccaccagtggcgcttccagcgcctttggccta
ggctctggagcgttcgcctcgtttgggtcggctaaaacccctaagacggcgggcaatcct
ttcgatatggccatggcctcggcgactcccaagaaggactctgccaaggctgttggaaaa
gcttctggcatggccgcgatttccgagagcaaccagtctggagcccccacggcccctctt
tcacatccgttgatagactcgtggaccttctggtaccgacccccgatttcaaaggcacac
ggctacatcgagtacgagaaaacactacatgaaatcgctactgtgcgaacagcggaggag
ttctgggagatgtatgcttacctaaagcgcccctccgtacttcccgttgtctcggacttt
catctgttcaagaagggtgtccgcccaatatgggaggatgatatcaacaagaagggcggg
aaatgggtggtgcgaatgaagaagggcgtgtccgaccgatactgggaagacctcctgctc
aacctcattggcgaccaattcggcgaggctggtgaggatgtctgcggcgctgtgttgagt
gtgcgcaatggcgaggacattctcagtatctggacacgaaccgatggtggtcgagtcatt
aaaattcgcgagaccatgaagcatgtcctcaacttcccacccaacactcgtgttgaattc
aagagccacgactccagtattcagcaacggacagccatagaagagtcacgccgcgaaaag
gctggtcaactccatcaccacgacaagcgtcacgctggtggagcttcgaagcaggcagct
gagcagtctcaatcatag

DBGET integrated database retrieval system