KEGG   Fusarium graminearum: FG06822.1Help
Entry
FG06822.1         CDS       T01038                                 

Definition
GYS_NEUCR Glycogen [starch] synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
fgr  Fusarium graminearum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FG06822.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     FG06822.1
Glycosyltransferases [BR:fgr01003]
 Polysaccharide
  Storage polysaccharide
   FG06822.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 704 aa AA seqDB search
MSSGGEQTRDIKNHLLFEIATEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNHQSA
AVEVEEMEPTNPEIAATIQSMRDRGVHIVYGRWLIEGAPRVILIDTKTAYGRMDEWKADL
WEAASIPSPPGDDETNEAIVFGYLVAWFLGEFVCHEKKKAVIAHFHEWLAGVALPLCKRR
RIDVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAAAHACDV
FTTVSHITAFESEHLLKRKPDGVLPNGLNVTKFSAVHEFQNLHQQAKEKIHDFVRGHFYG
HYDFDVDNTLYLFTAGRYEFRNKGVDMFIESLARLNHRLKASGSKITVVAFIIMPAQTTS
LTVEALKGQAVIKSLRDTTHVIEQSIGRRLFERSLKWHEGEPLPDEKELISAQDRVLLRR
RLFAMKRHGLPPIVTHNMLNDHEDPVLNQIRRVQLFNHPTDRVKVIFHPEFLNSANPVLP
LDYDDFVRGCHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYGI
YIVDRRTKGVDDSVNQLTSFMFDFCGKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQ
LALRRAYPNSFVGDEEEEDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQEGREGL
NTEDYVAWKLPEEEDPEEYPFPLTLRKQPAPPSPSETVPVNGTQ
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgagttccggaggcgagcaaactcgcgacatcaagaaccaccttctctttgagattgct
actgaagtagctcatcgagtcggtggtatctactctgttatcaagtccaaagctcctgtg
acaacagctgaatatggcgaccgctatacgctcattggtcctctcaaccaccaatcggcc
gctgtcgaagtggaagagatggagcccaccaacccagagattgctgctaccatacagtcc
atgagagacagaggagtccacattgtctatggacgctggttgatcgagggagctcccaga
gttattctcatcgacaccaagactgcctatggccgtatggatgagtggaaggccgatttg
tgggaagccgcgagcatcccctcaccacccggtgatgatgagaccaatgaagccatcgtt
ttcggttatctggttgcatggttcctgggcgagttcgtctgccacgagaagaagaaggct
gttattgctcacttccacgagtggcttgctggcgttgccctgcccctctgcaagaggcgc
cgcatcgatgttacgacgatctttaccacacacgctactcttctcggccgatacctttgc
gccggctccgtggacttttacaacaacttgcagtggttcgatgtcgacgctgaagctggc
aagcgtggtatataccacagatactgtattgagcgagccgccgcacatgcttgcgatgtt
ttcaccactgtttctcatatcacagcttttgagtctgagcatctgttgaagcgaaagccc
gatggcgttctgccgaatggtctcaacgtcacaaagttctctgctgttcacgagttccag
aacctgcaccagcaggcaaaggagaagatccacgactttgtccgcggacatttctatggc
cactacgacttcgatgttgataacacactctatcttttcactgctggtcgttacgagttc
aggaataagggtgttgacatgtttattgagtctctggcacgactgaaccaccgtctcaag
gcctctggaagcaagatcactgttgtggccttcatcatcatgcctgctcagaccacctca
ctcactgtcgaggcgctcaagggccaggcagttatcaagtccctgcgcgacaccacacac
gttatcgagcagagcattggacgtcgcctctttgagcgctccctcaagtggcacgagggt
gaacctctgcccgatgagaaggagcttatctctgcccaggacagagttctgcttcgtcgt
cgcctctttgccatgaagcgccacggacttcccccaattgtcacccataacatgctcaac
gatcatgaggatcccgttctcaaccagatccgccgtgtgcagcttttcaaccaccctacc
gatcgcgtcaaggttatcttccaccctgagttcctcaactctgccaaccccgtccttcct
ctcgactacgacgactttgttcgaggttgccatttgggtgtcttctcttcctactatgag
ccttggggttacactcccgccgaatgtaccgtcatgggtgtgcccagcattaccaccaac
ctttctggtttcggatgctacatggaggagcttattgagaactcgagcgactatggtatc
tacattgttgatcgacgaaccaagggtgttgacgattccgtcaaccagctcacttcattc
atgtttgacttctgtggaaagagccgacgtcaacgcatcaaccagcgaaaccgaaccgag
cgtcttagtgatcttctcgactggaagcgaatgggtatggagtatgtcaaggctcgccaa
ctggctcttcgccgtgcctatccgaactctttcgtcggcgacgaggaggaggaggacttc
atccctggtgttgagcagaagatttctcgacccttctctgttcccggctcgccacgggat
cgcactggcatgatgactcctggagactttgccagtctgcaagaaggtcgcgagggcctg
aacaccgaggactatgttgcctggaagcttcctgaagaagaggaccccgaagagtacccc
ttccctctgacacttcgaaagcagcccgcgccacctagcccctcagagaccgtaccggtg
aacggaacccagtag

DBGET integrated database retrieval system