KEGG   Fusarium graminearum: FG06961.1Help
Entry
FG06961.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
fgr  Fusarium graminearum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FG06961.1
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FG06961.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     FG06961.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 412 aa AA seqDB search
MRGNGTKSLTIVIKLGTSSIVDEKTHEPLLPILTLIVDTAVKLRKDGHRVVIVSSGAIGV
GLRRMDVEKRPKHLAQLQALAAIGQCRLMSLWDSLFTHLRQPIAQILLTRNDIADRTRYF
NAQNTFHALLEQGVIPIVNENDTLAVAEIKFGDNDTLSAITAAMIHADMLFLMTDVDCLY
DKNPRTHPDAKPIEVVEDIAALQADVSSAGSSLGTGGMSTKIIAARLGTSAGVTTVITRS
SNPGNVLHIVQYLQSIQRGNTPPSPDERAEGLTRSASALSLSASNGNGAPWPPLHTRFVP
ANNPIRDRHFWLLHTPYPHGTLYIDSGAYKALVGKAGLLPVGVVDVEGNFAQQEVVRLVT
VKRRSTPGPDVSMSLTDSMLASLGKVADQAKRRDRKMDKTGASEYISTYAAL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagaggaaacgggacaaagtccctgaccatcgtgatcaagcttggaacaagctcgatt
gtcgatgaaaagactcatgagccgcttcttcctattctcactctcattgttgacacagct
gtaaagctccgaaaggatggccacagagtagtcattgtttcgtcgggagccatcggcgtt
gggctccggcgtatggacgtagagaagcgacctaagcatctcgcacagctacaggcactc
gcggcgatcggtcaatgccgattgatgagtctatgggatagtttgttcactcatctcagg
cagccaattgcccagattctccttactcgaaacgatattgcagacagaactagatacttc
aatgcccaaaacaccttccatgcacttctggagcagggcgttattcccatcgtcaacgag
aatgacactctcgccgttgccgaaatcaagtttggcgacaacgatactctctccgccatc
actgccgccatgattcacgcagacatgttgttcttaatgacagatgttgactgtctgtac
gacaagaacccccgcacccacccagatgccaaacccattgaggtggtcgaggacattgcc
gcccttcaagctgatgtttccagtgctggctcatccctcggaactggaggcatgagtacc
aagattattgcagccagattgggcacttctgcgggtgtcacgactgtgattacaaggtca
tctaacccagggaacgtgcttcatattgtgcaatacctccaatcaatacaaagagggaac
acccctcccagtcctgatgagcgcgccgaaggtctgacacgttcagcgtcagctctgtca
ctgtcagcctccaatggaaatggtgccccctggccccccctacatacccgattcgtccct
gccaacaaccctatccgggaccgtcacttctggctgcttcacaccccctatccccacggc
accctctacattgactcgggagcttacaaggcacttgttgggaaggctggcctgctccct
gtaggcgtcgttgacgtcgagggtaactttgcccagcaggaagtagtgcggcttgtgaca
gtcaagagacgatcaactcctggaccggatgtgagtatgtcgctcaccgacagcatgttg
gcttctttgggaaaggtagcagaccaagcaaagagacgggaccgaaaaatggacaaaacg
ggggcaagcgaatacatttcaacatatgcagcgctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system