KEGG   Fusarium graminearum: FG07019.1Help
Entry
FG07019.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
fgr  Fusarium graminearum
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FG07019.1
  Carbohydrate metabolism
   00640 Propanoate metabolism
    FG07019.1
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FG07019.1
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FG07019.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     FG07019.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 480 aa AA seqDB search
MVQQGKVLSSSLGARQVSDEATTIKPLPEDEPNDVVFESKYGLRTMMLNRPQKLNSLNSS
MIRKMVPRLVEWEKSDLANVVVLKGAGHKALCAGGDVAALAEMNQQNETGWMRSSAYFAL
EYKLDHYIATYNKPYIAFMDGITMGGGVGLSAHAPFRIATENTVFAMPETGIGFFPDVGA
SFFLPRMNGSIGTYLALTSAQLRGPNVFYAGIATHYLHSTSLPDLEARLAELRFRDSDTL
PERLALINQTLEEFCTGLPHDQPIELTGAVRQAIDRCFNRHTITEIIAALKAEKGNSSTR
GWARQQLETLHKRSPTALHVALRQMRIGGEWDIAETFKREHQIATKFMQHHDFTEGVSAL
LIRKNAPVWEPESLAAIGGTNVAKPFFEYDDDHPLHLFTDRTYKEYPHQELGVPTEKEVE
KVLSQGTYTREELANKIIASRNGRQGISEVVADIIDRKTVVNDKRKAVWMKDEVAPGSRL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggttcagcaaggaaaggtcttgagctcctcgctcggtgctcgacaggtctcagatgag
gcgaccaccatcaagccattgcctgaagatgaacctaacgatgtggtcttcgaaagcaaa
tatggcttgcgaaccatgatgctcaatcgaccccagaagctcaactctcttaactcttca
atgatccgaaagatggtgcctagattggtcgagtgggaaaagtcagacctcgccaatgtt
gttgttttgaagggtgctggtcacaaggccctttgcgctggaggtgacgtcgccgcgctg
gcagagatgaaccagcagaatgagactggatggatgcgatcgtctgcatactttgctctc
gaatacaaactcgaccactatattgcgacatacaacaagccctacatcgcttttatggac
ggcatcaccatgggcggtggtgttggtctgagcgctcacgctcctttcagaatcgcgacc
gagaacaccgtcttcgccatgcccgagacaggcatcggatttttccccgacgtcggcgct
tctttcttcctccctcgaatgaacggatccatcgggacctatcttgcgctgaccagtgca
caactccgaggccccaacgtcttttacgccggcattgctacccactaccttcactcgacc
agcttgcctgatcttgaggcacgcctggctgaattacgattccgggacagcgacactctg
cctgaacgcctggcacttattaaccagactctcgaggaattctgcacaggtcttcctcat
gaccagcccattgaattgacaggcgcggttcggcaggcgattgatcgatgcttcaacagg
cacacaatcaccgagatcattgctgctttgaaagctgagaaagggaatagttctacgagg
gggtgggcgcgacaacaactagaaactctgcacaagcgatcgcccacggccttacacgta
gctctacgccagatgcgtattggtggcgagtgggatattgccgagaccttcaagagggaa
catcagattgctaccaagtttatgcagcatcacgattttaccgagggcgtgtcagcttta
ctcatcagaaagaatgcgcccgtgtgggagcccgagtctcttgcggccattggcggcacc
aatgtagccaagcccttcttcgaatacgacgacgaccatccactccacctcttcactgac
cgtacttacaaggagtatcctcaccaggagcttggtgtgcccacagagaaggaagttgaa
aaggttctttcccagggcacctacactcgggaagagctagccaacaagattatcgcatcg
cgtaacggtcgccaaggcatctctgaagttgttgcggatatcatcgatcgcaagactgtg
gtgaacgacaagagaaaggccgtgtggatgaaggacgaggttgcgcccggaagcagactg
taa

DBGET integrated database retrieval system