KEGG   Fusarium graminearum: FG07103.1Help
Entry
FG07103.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
fgr  Fusarium graminearum
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    FG07103.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     FG07103.1
Transfer RNA biogenesis [BR:fgr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    FG07103.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 352 aa AA seqDB search
MASYTRERQIAELAVLRASILTKRVQSTVSGISKADDSPVTAADFAAQAVLISALRKAFP
GDAFVGEEDSSALREDDALKQRVWELASNAHLENPDDEALLASPENVDELLEVIDLGGRG
QGGKKGRFWVMDPIDGTATFLKGEQYAVSLALVEDGREVVGVLGCANLKPVDGKVAESTI
DKDGLGLMLTAVRGQGTTIRKMEFNGLQPAQPLDSIAKASSLADSQIINYSSGSTSRHDL
ITKLADSFGAKFPNIELYSSHIRYAALLVGGGDFQLRVPSSSSVRMYIWDHAGAQLILTE
AGGKVTDLDGKEMDFAAGRDLNQNNGLLAAREGIHGAVLEGMGKILAEDASR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttacactcgtgaacgtcaaatcgcagagctcgccgtcttgcgggcctcaatc
cttaccaagagggtgcagtcaaccgtcagcggaatctcaaaagccgacgactcaccagtc
actgctgctgattttgccgctcaggcggttctcatcagtgctcttcgcaaggccttcccc
ggtgatgcctttgttggagaagaggattccagcgctctgagggaagatgacgccctgaag
cagcgtgtctgggaactggcttccaatgctcacctggagaacccagacgacgaagctctg
ctcgccagccccgagaatgtagacgagcttcttgaggtgattgatcttggaggtcgtggc
cagggtggcaaaaaggggcggttctgggtcatggatcccatcgacggaacggctacattc
ctcaagggtgaacagtatgctgtatccctggccttggtagaggacggtcgagaagttgtc
ggtgttctgggctgtgcaaacctgaagccagtagatggaaaagttgcagagtcaactatt
gacaaggacggcttgggtctcatgctcaccgcagttcgcggacaaggcacaacgatccgc
aaaatggagttcaacggtctccaacccgcccagcctctcgacagcatcgccaaagcttct
agccttgctgattcccaaatcatcaactactccagcggctctacctcgcgccacgacctc
attaccaagcttgccgactcatttggtgccaagttccccaacattgaactgtactcgtct
catatccgttacgcagcgctcctagttggtggtggtgactttcagcttcgtgtaccttcg
tctagcagtgtacgaatgtacatttgggaccatgccggtgcgcaactcatcttgactgag
gctggtggtaaagtaacagatctcgatggtaaggaaatggactttgcagctggaagggat
ttgaaccagaacaacggcctgctcgcagccagagaagggattcacggcgcagttctagag
ggcatgggaaagatcctggctgaagatgcttcgcgttga

DBGET integrated database retrieval system