KEGG   Fusarium graminearum: FG07210.1Help
Entry
FG07210.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fgr  Fusarium graminearum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FG07210.1
   00670 One carbon pool by folate
    FG07210.1
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     FG07210.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 201 aa AA seqDB search
MQSLELTLIVAATRNMGIGAQGGMPWQGLRKEMKYFARVTTRLPPQAPSPSLNAVIMGRK
TWDSIPTKFRPLKDRLNIVISRSAPLNLPETVELTEPVRVQSLELALQYARARSDINRVF
VIGGAQIYDAALKLPEARRILLTSIERDFDCDTFFPVDLKGGKWERKSREELQEWTGEEI
EEGGQEEAGTKYEFQMWEKNE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctctcgaactcaccctcatagtcgctgcgactcgtaatatgggcatcggcgcc
caaggaggaatgccctggcaaggcttgcgcaaagaaatgaagtactttgcacgtgtgacg
acaagactgccgccacaggccccttcaccatcgctcaacgcagtcataatgggccgtaaa
acctgggactcaatccccaccaaattccgacctctaaaagaccgtctcaatatcgtcata
agccgttccgcacccttgaacctccccgagacagttgaactcacagagcccgtcagagtt
cagtctcttgagctcgcgctgcagtacgctcgtgctcgcagcgacatcaaccgtgtcttt
gtcattggcggtgcccagatctacgatgctgcactcaagctgcccgaggcgcgacgcatc
ctgctcaccagcattgaacgggattttgactgtgatacgttcttccccgtggacctgaag
ggtggcaagtgggagaggaagtcgagagaggagttgcaggagtggacgggcgaggagatt
gaagaaggtggtcaagaggaggcagggacaaagtatgagttccaaatgtgggaaaagaat
gagtag

DBGET integrated database retrieval system