KEGG   Fusarium graminearum: FG07251.1Help
Entry
FG07251.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
fgr  Fusarium graminearum
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    FG07251.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     FG07251.1
Protein kinases [BR:fgr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   FG07251.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 591 aa AA seqDB search
MPSLGFLKKKRTREGNSDPSASSPTSPVTPTTSRSKSISKAFHLPRNNRHSTSAPTAQPT
NAQQQSQQQPEHQHQEGAAPQSNQPPAQNQQTAGASDGQQDHDMDTIKLHKPEYGTNSMS
PHDHQNLPSINNLINQPQQQQNAQGNSYNNAQSNPQFLAATIDNHRPQTVSPGTDPATLQ
QQQQQAMPQPPQQQQPSDNQQSQQRYQHQQQPQAQQQQQQQQPQQQSQQFQQQQHQEQNQ
NQNQNEAQQQPQQQPRQPGHQYTNSVMRVTKGKYSLGDFDILRTLGTGSFGRVHLVQSKH
NQRFYAVKVLKKAQVVKMKQVEHTNDERRMLADVKHPFLITLWGTFQDSKNLYMVMDFVE
GGELFSLLRKSGRFPNPVAKFYAAEVTLALEYLHSKNIIYRDLKPENLLLDRHGHLKITD
FGFAKRVPDKTWTLCGTPDYLAPEVVSNKGYNKSVDWWSLGILIYEMLCGYTPFWDSGSP
MKIYENILKGKVKYPAYVNADAQNLLERLITADLTKRLGNLYGGPADVKNHPWFAEVTWD
RLARKDIDAPYTPPVKAGAGDASQFDRYPEDPEKYGMVGGTDEYGHMFTEF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgccttcactggggtttctcaagaaaaagcggaccagagagggcaactctgacccttcg
gcctcaagtccaaccagcccagtcactcctaccacgtccaggtccaagtccatctctaaa
gcttttcacctgcctcgaaacaacagacattccacctcagccccgactgcccagccaacc
aacgcccagcaacaatcgcagcaacagcccgaacatcaacaccaggaaggcgccgcgcct
caatccaatcagcctcctgcgcaaaaccaacaaacggcaggtgcctccgacggccagcaa
gatcacgatatggacacaatcaagcttcacaagcccgagtacgggacaaattccatgagc
ccacacgatcatcaaaatcttccaagcatcaataatcttatcaaccagcctcagcagcag
caaaatgcccagggcaattcctataacaacgcccagagcaacccgcagttcttagctgcg
acaatagataatcatcgtccacaaaccgtcagccctggaactgatcccgcaaccctccag
cagcaacagcagcaggccatgccacagcctcctcagcaacagcagccttctgacaaccag
cagtctcagcaacgataccaacatcagcagcaaccgcaggcccagcaacagcaacagcaa
cagcagcctcaacaacagtcgcagcagtttcaacaacagcaacaccaggaacagaaccag
aaccagaaccagaacgaggcgcagcagcagccacaacagcagcctcgtcagcctggtcac
cagtataccaattccgtgatgcgcgtcacgaaaggcaagtactcgcttggtgacttcgat
atcttgaggacgcttggaactggtagcttcggccgtgtccatctagtccaatcgaagcac
aaccagcgtttctatgctgtcaaagtgctcaagaaggcacaggtggtcaagatgaagcag
gttgagcataccaatgacgaacgacgcatgctggctgatgtcaagcacccttttcttatc
actctttggggtacctttcaggactcaaagaacctctacatggtgatggactttgttgaa
ggtggcgagctgttttctcttctgaggaagtctggtcgcttccctaaccctgtagccaaa
ttctacgcggcagaggtcactttagccttggaatacctccattccaagaatatcatctac
cgtgatctcaagccagaaaacttgctacttgatcgacatggccacctcaagattacagat
ttcggcttcgcgaagcgtgtgcccgacaagacttggaccctgtgcggcacacctgattac
ttagcccccgaagtggtctctaataagggttacaacaaatctgtggattggtggtcgttg
ggtattctgatatacgaaatgctttgtggttacacgccattctgggacagtggatctccg
atgaagatctacgaaaacattctcaagggcaaggtcaaatatcccgcatacgttaacgca
gacgcccagaatctcctggagcgtctgatcacagccgatttgacgaagcgattgggcaac
ttgtacggaggcccagcagatgtgaagaaccacccttggtttgccgaagtcacctgggac
cgactagccaggaaggacatagatgctccgtatacgccaccggtcaaagcaggtgctggt
gacgccagccagttcgatcgttatcctgaggaccctgaaaaatatggaatggttggagga
acagatgagtacggacacatgttcacagagttttaa

DBGET integrated database retrieval system