KEGG   Fusarium graminearum: FG07254.1Help
Entry
FG07254.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     FG07254.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 478 aa AA seqDB search
MEDTTQLLTFFKGLSDASTAIHISLVSPSESGLQHVATFNPRHTYSIFGDDEKIFGYQDL
KVNLRYRANDMRPHLNISYSKKSGTINELEPTDVAAILDEGNHLPKTRDFEESSKQLSDD
WTPPGKLHTTFDSPEGQYEIWCGNLADPAVKQLNSRLQIFVPLFIEGGTYIGQDPDEDSA
ELDLSDADRWTFFSLYQKRKVGDKTAYVFVGYSTIYRFYYFQPPTPPASPQSDEWELPNG
NMDLGELPCRTRLSQFIILPPFQGKGNGARLYKTIFEHYHKIPQTYEFTVEDPNEAFDDL
RDICDLQFLRKMPEFNNLLVDTNIKIPKKGFLPKLIIGSSLLEEIRLRAKIAPRQFGRVL
EMHLMSKLPVSVRPTMAIEDQPAATKADQHEAKVWGLIVKQRLYRHNKEVLSQIEPAERV
EKLDDTLHGVGLEYARILAAVDRSDKYEGQTTASSKRKLDADEITEDLSNKKARVEDA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaagacaccacgcagttattgacatttttcaaagggctgtctgacgccagcacggcc
atccacatcagccttgtatctccctccgaatctggtctccagcatgttgcgacctttaat
ccccgacacacctattcgattttcggcgatgatgagaagatctttgggtaccaggacctc
aaggtcaaccttcgatatcgcgccaacgacatgcgaccgcacctgaacatttcatacagc
aagaagtccggcacaatcaacgaacttgaacctacagatgttgcagctatccttgatgag
ggcaaccatctccccaaaactagggattttgaggaaagctccaagcaactgagcgacgat
tggacaccaccaggaaagcttcacacaaccttcgacagtccagagggccaatatgaaatc
tggtgcggaaaccttgccgaccccgctgtcaagcagctcaacagccgtttgcaaatattc
gtacctctcttcattgaagggggtacctatattggccaagaccctgatgaggactcagcc
gagctcgacctgtccgatgccgaccgctggaccttcttcagcctctaccagaagcgcaag
gtgggagacaagaccgcctatgtgtttgtaggctactcgaccatctaccgattctactac
ttccagcctcccaccccaccggcatcaccacagagcgacgagtgggaattgcccaatggc
aacatggaccttggcgagctcccttgcagaacaagactttctcaattcatcatcctgcct
cctttccagggcaagggcaatggtgcgcgactctacaagactattttcgagcactaccac
aaaatcccacaaacgtacgagttcactgtggaggaccccaacgaggcattcgacgacttg
cgagacatatgtgacctgcaattccttcggaaaatgccagagttcaacaatttgctagtc
gacaccaatattaaaatccctaagaaggggttcctcccaaagctaattataggctcctca
ctccttgaagagattcgactccgagccaaaatcgctccccgtcaattcggacgagttctt
gagatgcatttgatgtccaagctccccgtatcagtacgaccaaccatggcgatcgaagat
caaccggctgcgacaaaggctgatcagcacgaagccaaagtatggggcttgatcgtgaag
cagcgactttaccgtcacaacaaagaagttctttctcaaattgaacctgctgagcgtgtg
gagaagctcgatgacaccctgcatggcgttgggcttgagtatgcgcgtatcttggctgct
gtcgatcgctcagataagtacgagggccagacaacagctagcagtaagcgaaagcttgac
gcggatgagattacggaagatttgagcaacaagaaggctcgagtggaagatgcctga

DBGET integrated database retrieval system