KEGG   Fusarium graminearum: FG07263.1Help
Entry
FG07263.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K03885  
NADH dehydrogenase [EC:1.6.99.3]
Organism
fgr  Fusarium graminearum
Pathway
Oxidative phosphorylation
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:fgr00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 476 aa AA seqDB search
MVMGTSPIALARQPRLLMRLSGLNSKRLASTAALEGSGWAGYALAKKISPSAASCVLISP
RSHFVFTPLIASTAVGTLEFRAAVEPCRKLTHTEFHQAWASDIDFANKSITVEANHRDGV
TARSGKDLKGPEFQIPYDKLVVAVGCYSQTFGVEGVKEHACFLRDATDARTVRLRVLQKF
EQAALPSTNTAERKRLLHFAVVGGGPTGIEFAAELHDLIHEDLSKLYPDLMPHVAITIYD
IAPKVLPMFDQNLAAYATNIFKREGIRIKTEHHLQGIRRQGDVLLMRIKEEPEEVAAGVV
VWSTGLMQNPLVGKTVGREVEGLGKIAKNDKTGGFAVDSHLRVQVESRDLNGKEITKSLP
DVYAIGDCANIEGQALPATAQVASQQATYLGKRFNSGISSQGPPTAPFHFRNWGTMAYLG
GWRAIHQNGADELKGRAAWILWRTAYLTKSMSFKNKLMIPYYWLITWIFGRDISRF
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggtcatggggacgagccccattgctcttgcacgtcaaccacgcttgttgatgaggctc
agtggactaaattccaagaggctagccagtactgcggctcttgaaggctcagggtgggct
ggatatgctcttgcaaagaaaatatccccttcagcagcatcctgtgttctcatctctcct
cgctctcacttcgtctttactcctctcatcgcctcaacagccgttggtactctcgagttt
cgtgccgctgttgagccctgtcgaaaacttacccatacagagttccatcaagcctgggct
tcagatattgactttgccaacaagagcatcaccgtcgaggccaaccatcgcgatggagtc
acagctcgctcgggtaaggatctcaaaggccccgagttccagattccctacgacaagctc
gttgtagccgttggttgctacagccaaacctttggtgtcgaaggtgtgaaggagcatgca
tgctttcttcgagatgccactgatgctcgaaccgtgcgcttaagagttttgcaaaagttt
gaacaggctgctttgcctagcacaaacactgctgagagaaaacggctgcttcactttgca
gttgtaggtggtggtcccaccggtatcgagtttgcagctgagcttcatgatcttatacat
gaggatctgtccaagctatatccagatctgatgcctcacgtcgccattacaatttatgat
atcgcacccaaggttcttcccatgtttgatcagaacctagccgcatacgcaacaaatatc
ttcaagcgagaaggcatccgcatcaagacagagcatcacctacaaggcattcgtcgccag
ggcgatgtcctcctcatgcgtataaaggaggagcccgaggaagtcgcagcaggtgttgta
gtctggagtacagggctcatgcagaatccactcgttggaaagacagtcggtcgtgaagtc
gaaggtttgggcaagattgcaaaaaacgacaaaacaggtggttttgcggttgactcccat
ctccgcgtgcaagtggaaagcagagatctcaatggtaaagagatcacaaagtcattgcct
gatgtgtacgccattggagattgtgcaaacattgaaggccaggcacttcctgcaacagcc
caagtggcgagccaacaagcaacatatctcggcaagcgattcaattctggtatttcgtca
caaggccctcctactgcacccttccatttccgtaactggggaactatggcataccttgga
ggttggagggcgattcatcagaatggcgctgacgagctcaaaggccgagcggcgtggatt
ctttggcgtacggcgtacttgaccaaaagtatgagtttcaagaacaaactcatgattcct
tattattggttaatcacttggatctttggacgagatatttcgagattttga

DBGET integrated database retrieval system