KEGG   Fusarium graminearum: FG07295.1Help
Entry
FG07295.1         CDS       T01038                                 

Definition
similar to AF525688_1 MAP kinase kinase; MKK1
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
fgr  Fusarium graminearum
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:fgr04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 524 aa AA seqDB search
MADQQPQGNDPTPQPQQSAAPTPISLPTHNSGPSPVPLLRPAIPGARNGGARTPRLGLAI
PPSPNAKPVGNQPIAAPSRPPLPTLHLATPMGSQVAPQEQLPRSQCVTQASAGGGSESSA
AHSRSGSFGPLDGRASNPTSAGSQYSALSFASQYGIGVSRPQGTPDPVSAVGSMYSERSE
GGVSMERDGSLQGLEAFDKLTIEKARTLDVDDLDEEGWRIASLEKRIVEIGNLGEGAGGA
VTRCKLKGGNTVFALKVITTNPDPDVKKQILRELGFNKECASDHICKYYGAFVDPSTATI
SIAMEFCEGGSLDSIYKEVKRLGGRTGEKVLGKIAEGVLGGLTYLHTRRIIHRDIKPSNI
LLCRDGAVKLCDFGVSGDFGTKGEANTFIGTSYYMAPERITGQSYTITSDVWSTGVTLLE
VAQHRFPFPADGTEMQPRANLIDLLTYIVRQDVPKLKDEPDMDVYWSNNFKYFIECCLEK
QPNRRASPWKMMEHPWMVEMRSKRVNMVKYLSYVWGWGDQPKDS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccaacagcctcagggcaatgacccaactccccaacctcaacaatccgccgcc
cctactccgatctctctcccaacacacaactctggcccctcgcccgttcctcttctccga
cctgccattcctggcgcaagaaatggcggagctcgcacaccgagacttggtcttgctatt
cccccatcacccaatgccaaaccagtaggcaaccaaccaatagccgctccttcaaggccg
cctctgccaacactgcatctggcaactcccatgggcagccaagtagctccccaagaacaa
ctccctcgatctcagtgcgtcacccaggcatcggcaggcggcggtagcgagagcagtgct
gctcactcaaggtctggtagcttcggtcccctggatggtcgggcaagcaaccccacttct
gcaggatctcaatactcagctctatccttcgcctctcagtatggcattggtgtatcaaga
cctcaaggaaccccagaccctgtgtctgctgtgggatctatgtattctgagagaagtgaa
ggtggcgtttctatggagcgtgacggaagcttgcagggattggaagcttttgacaagctg
actatcgagaaagccagaactcttgatgtcgatgatcttgatgaagagggttggagaatc
gccagtcttgaaaagagaattgtcgaaattggaaaccttggtgagggtgctggcggcgcc
gtcacaagatgtaagctcaagggtggcaacactgtttttgctctgaaggtcatcactacg
aatccagatcctgacgtgaagaagcagatcctccgagagctaggattcaacaaagagtgc
gcttcagaccacatttgcaaatactatggtgcatttgtggacccatctacggccactatc
tctatcgccatggaattctgtgaaggtggctcactcgacagcatttacaaggaagtgaaa
cgcctgggaggcagaaccggagagaaagtgctgggtaaaattgctgagggcgttctcggt
ggtttgacatacctgcatacccgacgaatcattcatcgagatatcaagccttccaatatt
ctgctgtgtcgagacggtgccgtcaagctttgcgatttcggtgtctcgggtgactttggt
accaagggcgaggccaatacctttatcggcaccagttactacatggcccctgagcgtatt
acaggccagtcgtatactatcacctcggatgtctggtcaacaggagttactctccttgag
gtcgcccaacatcgattcccattccccgcagatggcactgagatgcaaccacgcgccaac
ctcatcgatctgcttacctacatcgtcaggcaggatgtgccaaaactgaaggacgagcct
gatatggacgtgtactggagtaacaacttcaaatactttattgagtgctgcttggaaaag
caacccaaccgccgagctagcccctggaagatgatggaacacccatggatggttgagatg
cgcagcaagcgcgttaacatggtgaagtatctttcttacgtctggggttggggagaccag
cccaaggactcttag

DBGET integrated database retrieval system