KEGG   Fusarium graminearum: FG07404.1Help
Entry
FG07404.1         CDS       T01038                                 

Definition
CALB_NEUCR Calcineurin B subunit (Protein phosphatase 2B regulatory subunit) (Calcineurin regulatory subunit)
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
fgr  Fusarium graminearum
Brite
Protein phosphatases and associated proteins [BR:fgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     FG07404.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 179 aa AA seqDB search
MGNTTSAVLDNLVQGSNYVRFLVDREEVDRLRKRFMKLDKDNSGTIERDEFLSLPQISSN
PLATRMIAIFDEDGGGDVDFQEFVTGLSAFSSKGNKEQKLQFAFKVYDIDRDGYISNGEL
FIVLKMMVGSNLKDQQLQQIVDKTIMEADLDKDGKISFEEFTKMVENTDISMSMTVDQF
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaccaccagcgcagtcctggacaacctcgtccaaggatccaactatgtgcga
tttctagtcgacagagaggaagttgatcgtctgcgaaagcgattcatgaaactggacaag
gacaactccggtacgatcgagcgcgatgaattcctcagtcttcctcagatctcttccaac
cctctggcaacacgaatgattgccatctttgacgaggatggtggtggtgacgtcgatttc
caggagttcgttacaggtctttcggcgtttagcagcaagggaaataaggagcagaagctt
caattcgccttcaaggtctacgatattgaccgcgatggatacatcagcaacggagagctt
ttcattgtcctcaagatgatggttggcagcaacctcaaggaccagcagctgcagcagatc
gtggacaagaccatcatggaggccgatcttgacaaggatggaaagattagcttcgaggag
ttcaccaagatggtggaaaacaccgatattagcatgagcatgactgttgaccagttctaa

DBGET integrated database retrieval system