KEGG   Fusarium graminearum: FG07596.1Help
Entry
FG07596.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
fgr  Fusarium graminearum
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    FG07596.1
  Amino acid metabolism
   00380 Tryptophan metabolism
    FG07596.1
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     FG07596.1
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     FG07596.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1066 aa AA seqDB search
MAIKDGGKKSGQIPGPKGLPVLGNLFDLDLSDSLTSLINIGQKYAPIFSLELGGHREVMI
CSRDLLDELCDETRFHKIVTGGVDKLRPLAGDGLFTAQHGNHDWGIAHRILMPLFGPLKI
REMFDDMQDVSEQLCLKWARLGPSATIDVANDFTRLTLDTIALCTMGYRFNSFYSNDKMH
PFVDSMVAALIDADKQSMFPDFIGACRVKALSAFRKHAAIMKGTCNELIQERRKNPIEGT
DLLTAMMEGKDPKTGEGMSDDLIVQNLITFLIAGHETTSGLLSFAFYYLLENPHTLEKAR
AEVDEVVGDQALNVDHLTKMPYVNMILRETLRLMPTAPGFFVTPHKDEIIGGKYAVPANE
SLFCFLHLIHRDPKVWGADAEEFRPERMADEFFEALPKNAWKPFGNGMRGCIGREFAWQE
AKLITVMILQNFELSKADPSYKLKIKQSLTIKPDGFNMHAKLRNDRKVSGLFKAPSLSSQ
QPSLSSRQSINAINAKDLKPISIFYGSNTGTCEALAQKLSADCVASGFMPSKPLPLDMAT
KNLSKDGPNILLAASYDGRPSDNAEEFTKWAESLKPGELEGVQFAVFGCGHKDWVSTYFK
IPKILDKCLADAGAERLVEIGLTDASTGRLYSDFDDWENQKLFTELSKRQGVTPTDDSHL
ELNVTVIQPQNNDMGGNFKRAEVVENTLLTYPGVSRKHSLLLKLPKDMEYTPGDHVLVLP
KNPPQLVEQAMSCFGVDSDTALTISSKRPTFLPTDTPILISSLLSSLVELSQTVSRTSLK
RLADFADDDDTKACVERIAGDDYTVEVEEQRMSLLDILRKYPGINMPLSTFLSMLPQMRP
RTYSFASAPEWKQGHGMLLFSVVEAEEGTVSRPGGLATNYMAQLRQGDSILVEPRPCRPE
LRTTMMLPEPKVPIIMIAVGAGLAPFLGYLQKRFLQAQSQRTALPPCTLLFGCRGAKMDD
ICRAQLDEYSRAGVVSVHRAYSRDPDSQCKYVQGLVTKHSETLAKQWAQGAIVMVCSGKK
VSDGVMNVLSPILFAEEKRSGMTGADSVDVWRQNVPKERMILEVFG
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaaagatggtggaaagaagagtggccaaattccaggccccaaaggcctccct
gtactcggcaacctcttcgatctcgacctcagcgactctctcacatccctgataaacatt
ggtcaaaaatacgcacccatcttctctctggaactcggtggccacagagaggttatgata
tgcagccgcgatctcctcgacgaactatgcgacgaaacaagattccacaaaatcgttacc
ggcggtgttgataagctacgacctttggccggagatggtctcttcacagcacaacatggc
aaccacgactggggaattgcgcatcgtattctcatgcctctttttggacctctcaagatt
agagaaatgtttgatgacatgcaagatgtctctgaacaactgtgtctcaagtgggctcgt
ctaggaccctcagcaaccatcgacgtagccaacgacttcacccgcctcacactagatacc
atcgccctatgcacaatgggataccgcttcaacagcttctacagcaacgacaagatgcac
ccgtttgtcgacagcatggtcgccgccctcatcgacgccgacaaacaatccatgtttccc
gatttcattggcgcatgcagagtcaaggcactgtccgcattccgcaaacacgccgctatc
atgaagggcacatgtaacgagctcatccaagaacgacgcaagaaccctatcgagggaaca
gacttgctcactgccatgatggaaggcaaagaccccaagacaggagagggcatgagcgat
gatttgatcgtgcagaacctcatcactttccttattgctggacacgagaccacctcaggt
cttttgtcgtttgccttttactatctcctcgaaaacccccacactcttgagaaggccagg
gcagaggtcgacgaggtggttggcgaccaggccttgaacgtcgatcatctaacaaagatg
ccatacgtcaacatgatcctcagagagactctccgcctgatgcccactgccccaggattc
tttgttacaccccacaaagatgagattattggcggcaagtacgctgtccctgctaatgaa
tcattgttctgcttcctccatcttatccatcgcgaccctaaagtctggggtgctgatgct
gaggagttcagacctgaacgcatggctgatgagttctttgaggctttacccaagaatgct
tggaagcctttcggtaacggtatgcgaggatgtatcggtcgtgagtttgcttggcaagaa
gccaagctgatcaccgtcatgatcctacagaactttgaactctccaaagccgacccaagc
tacaagctcaagatcaagcagtccctcactatcaagcccgacggtttcaacatgcacgcc
aaactccgcaacgaccgaaaggtctctggtctcttcaaggctcctagtctttcaagccaa
cagcccagcctgtccagccgtcaaagcattaacgccatcaatgccaaggacttgaagccc
atctccatcttctacggctccaacactggaacgtgtgaagcactggcacaaaagctatct
gctgattgcgtcgcttctgggttcatgccttccaagcctttgcctcttgacatggctacg
aagaacctttccaaggatgggcctaatatcttactcgctgcttcgtatgacgggagacct
tctgataacgcggaagagttcaccaagtgggctgagtcgctaaagcctggggagttggag
ggtgtccagtttgcagttttcggatgtggccacaaggattgggtttccacatacttcaag
atccccaagatcctggacaagtgtttggcagacgccggcgcagagcgacttgtcgagatc
ggtctcacagacgccagcactggtcgcttgtactccgactttgacgactgggagaaccag
aagctcttcaccgaactgtctaagcgccaaggtgtcacgccaactgacgactctcatcta
gagctgaacgtcaccgtcatccagccccagaacaatgatatgggcggtaacttcaagcgc
gccgaggtcgtcgagaacacactcctcacatatcctggagtctctcgcaagcacagcctg
ttgctgaaactgcccaaggatatggagtacacacctggtgatcacgttctggttcttccc
aagaacccgcctcagttggtggagcaggccatgtcgtgctttggagtggatagcgatact
gcgttgacgatatcctccaagaggccgacattcttgccgactgatacaccaattctcatc
tctagtcttctcagttctcttgttgagttgtctcagactgtcagtcggacaagtctcaag
cgactggctgactttgctgatgatgacgacacaaaggcatgcgttgagcgtattgctggt
gatgactacaccgttgaagttgaggagcagcggatgtcccttcttgacatcttacgcaag
tacccgggcatcaacatgcctctctctacattcctctccatgctacctcaaatgcgtccc
cgaacatactccttcgcttcagcgcctgagtggaagcaagggcacggtatgcttctgttc
tctgtggtcgaagctgaagagggaacagtttctcgaccgggcggtcttgctaccaactac
atggctcaattgagacaaggtgattctatcctagtggaaccgcgaccctgtaggccggag
ctgcgcacaacgatgatgcttcctgaacccaaggtgccaatcatcatgatcgctgtgggc
gctggattggcaccattccttggttacttgcagaagcgctttttgcaagcgcagagccag
cgcactgctctcccaccttgtactctgctctttggttgcagaggtgcaaagatggatgac
atttgtcgcgctcaactcgacgagtactctcgcgcgggcgtagtctccgtccaccgagct
tacagtcgagacccagattctcagtgcaagtatgtgcaaggcttggttacaaagcacagt
gagactctagccaagcagtgggctcaaggtgctattgtcatggtctgcagtgggaagaag
gtgtctgatggtgtgatgaatgttttgagtccaatcctgtttgctgaggagaagagatca
ggaatgacaggtgcagacagtgttgatgtttggagacaaaacgtgcctaaggagcgcatg
attctggaggtatttgggtaa

DBGET integrated database retrieval system