KEGG   Fusarium graminearum: FG07872.1Help
Entry
FG07872.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     FG07872.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 240 aa AA seqDB search
MAWTCSGDTNSALIENMWKNGLITDARVKEAFLKVDRTHYAPAMPYEDSPQPIGYSATIS
APHMHASAVEHVLSYLLPSSASPSPRILDVGSGSGYLTHVMAELVGEKGLVVGLEHIRQL
KELGENNMAKSDQGRRFLETGKVRFRYGDGRKGWVEEPREGEQHEGTGWDVIHVGASAVE
IHPELIEQLKAPGCMFIPVDDDKMGYNQHVWRIEKDGNGEVTKKKLFGVRYVPLTEAPKE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcttggacgtgcagtggtgacacaaactcggcgctgatagagaatatgtggaagaat
gggcttatcactgatgcgcgagtgaaggaggcattcctcaaagtcgaccgcacacactac
gctccagcgatgccatacgaagactctccccagcccatcggttactcagccactatatct
gcaccacatatgcacgcttcagccgtcgaacacgtcctaagctatcttctcccatcgtct
gcctcgccgtccccgcgcattctcgacgtcggttccgggtctggttatttaacacatgtg
atggctgagcttgttggcgagaagggtcttgtcgtagggctggaacatatcagacagttg
aaagagctaggcgagaataatatggcaaaaagtgaccagggaagaagattcctagaaact
ggaaaggtgagatttcggtatggcgacgggagaaaggggtgggtcgaggaaccgagagag
ggtgaacaacatgaaggaacgggatgggatgttatccatgttggagcttcagctgtggag
attcatcccgagttaattgagcagttgaaggctcctgggtgcatgtttataccggttgac
gatgataagatgggatataatcagcatgtgtggaggattgagaaggatggcaatggggag
gttaccaagaagaagttgtttggcgttcgatatgttccgttaaccgaggcgccgaaggag
tag

DBGET integrated database retrieval system