KEGG   Fusarium graminearum: FG07958.1Help
Entry
FG07958.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     FG07958.1
Peptidases [BR:fgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   FG07958.1
Transcription machinery [BR:fgr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     FG07958.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 436 aa AA seqDB search
MSARPTTPASPKNVRVKSPVPGLPMFGCDVDSRSGCLYCQICDDYIWDPTLEELRVRKIG
TGSFSGRKRKHDELFTGSFKDDPRFISSNTNTASCRANGLRGIYNAGATCYQNVVLQSFL
HNPLLRNFYLSDGHQSSDCQVSHCLSCAMDDMFQDFYALETTNGYTAANILSGFWISEKK
AFENLVTTKEQDAHEFFQFLAEELHERNGDGKKPEIGSEHSCNCIMHQTFYGKMQTTTTC
QNCSGQSNSIQSFLDLSLGLDNVVQKKSKRTGQKKPTVSLQDCLDEEYIKYDKCEYRCNN
CNGTQQAKRHTSIKRLPNVLSIQLKRFEYKHGRHDRAASKVDNEVKFPLQLNMMPYTNRI
RNHDSRESLELERSCTYDLLSVVVHVGELDTGHYTSYCRVGDQWFKFNDHKVELASLSDV
LGAQAYLLFYIIRSLA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacgaccaacaacaccagcctctcctaagaatgtcagggtgaagtcgccggtt
cctggattgcccatgtttggctgcgatgtcgactcgagaagtggctgcctttattgtcag
atatgcgacgactatatctgggatccaactctcgaggagctacgcgtgagaaagatagga
actggttctttttctggccgaaagaggaaacacgacgagctgttcacgggttcttttaag
gatgacccgcggtttatctctagcaatacaaacaccgcttcatgccgagccaatggtcta
cgtggcatctacaacgccggcgccacctgctatcagaatgtcgtcctacaaagcttcttg
cacaatcctttgcttaggaatttctatcttagcgatggtcaccagagcagtgactgccaa
gtctctcactgtttgagctgtgctatggatgacatgtttcaagatttctatgctctggag
acgacaaacggctataccgctgcaaatatattgtcggggttctggatttcggagaaaaag
gcgttcgagaaccttgttaccaccaaggaacaagatgcccacgagttcttccaattcttg
gctgaagagctccacgagcggaacggagacggcaaaaagccagagatcggcagtgagcat
agttgcaactgcatcatgcaccaaacattttatggtaagatgcaaacaacaacaacgtgc
cagaactgctcgggtcaaagcaactctatccagtcattcttggacctgagcttaggcctc
gacaatgttgttcaaaagaagagcaaacggacagggcagaagaagcctactgtctccttg
caggattgtctcgatgaggaatacatcaagtacgacaagtgcgagtatcgatgcaacaac
tgcaatgggacccagcaagcgaaacgacacacgagcataaaacgattgccaaatgtgctg
tcgatacagcttaagcgttttgagtataagcacggccggcatgatcgcgctgcctccaaa
gtcgacaacgaagtcaagtttccgctacaactcaatatgatgccatacactaatcgaatt
cggaatcacgacagccgagaaagccttgagctggagcggtcttgtacgtatgatctactc
agtgtcgtggtgcacgtcggtgagctagatactggccactacacatcatattgtcgagtt
ggtgaccagtggttcaaattcaatgaccacaaagtagagctggcgagcttgtctgacgtc
cttggcgcccaagcctatcttctcttctacattattcgctcactggcctaa

DBGET integrated database retrieval system