KEGG   Fusarium graminearum: FG07970.1Help
Entry
FG07970.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fgr  Fusarium graminearum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FG07970.1
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FG07970.1
  Amino acid metabolism
   00310 Lysine degradation
    FG07970.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FG07970.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 421 aa AA seqDB search
MLSRSIATASRMVPARVLRPRAHPLVMLPAMMQTVRTYADSVIKVPQMAESISEGTLKQF
SKSIGDYVAQDEEIATIETDKIDVAVNATEAGTIKEFLVAEEDTVTVGQDLVRIELGGEP
SGDKKEAPKEEPKKSESESKPEPKQESAPEPKKEPAAASSKPEAPRQPEKKESKSESSAS
SGSSMGNREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSNIMEFRKLYKEDVLK
KTGVKLGFMSAFSRACVLAMRDLPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTP
VVRNVESMDMIGIEESIADMGKKARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQ
SAVLGLHAIKERPVAVNGKIEIRPMMYLALTYDHRLLDGREAVQFLVKVKEYIEDPRRML
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcaagaagtatagctaccgccagccgcatggtgcccgctcgggtgctgcggcca
cgtgcgcatcctctcgtcatgcttcctgccatgatgcagaccgttcgcacatacgccgat
tccgtcatcaaggtcccccagatggctgagtctatttctgagggtactctcaaacagttt
tccaagagcattggcgattacgttgcccaggacgaggaaattgctacaattgagactgac
aagattgacgttgccgtcaacgcaactgaggctggcaccattaaggagtttcttgtcgca
gaggaggacactgtcactgtcggccaggatcttgttcgcatcgagcttggtggtgagcca
tctggtgacaagaaggaggcccctaaggaggagcccaagaagtctgagtctgagtcaaaa
cctgagcccaagcaagagtctgcccccgagcccaagaaggaacccgctgctgcctccagc
aagcctgaggctcctcgacagcccgagaagaaggaatcaaagtccgaatcctctgcctca
agtggttcctcaatgggcaaccgcgaggagcgtcgtgtcaagatgaaccgcatgcgcctc
cgaattgccgagcgtctcaagcaatctcagaacactgctgcatccctgaccaccttcaac
gaggtcgacatgtccaacataatggagttccgaaagctctacaaggaggacgtcctcaag
aagactggtgtcaagctgggtttcatgagcgccttctcccgagcttgcgttcttgctatg
cgcgacctgcctgccgtcaatgcctccattgagggacccaacggcggtgataccatcgtt
taccgcgactacgttgatatcagtgttgccgttgccactgagaagggcctcgtgactccc
gttgtccgaaatgtcgagtccatggacatgattggtattgaggaatcgattgctgatatg
ggcaagaaggctcgcgacaacaagctcactatcgaggatatggctggtggtactttcacc
atcagcaacggtggtgtttttggctcacttatgggcacccccattatcaaccttccccag
agcgccgttcttggtctccatgccattaaagagcgccctgtcgctgtcaacggcaagatc
gagattcggcccatgatgtatcttgcccttacctatgaccaccgtctgctggatggccgg
gaggctgtgcaattccttgttaaggtaaaggagtatattgaggaccctcgaagaatgctt
ctgtaa

DBGET integrated database retrieval system