KEGG   Fusarium graminearum: FG08133.1Help
Entry
FG08133.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
fgr  Fusarium graminearum
Brite
Protein kinases [BR:fgr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   FG08133.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 2423 aa AA seqDB search
MAQAQQIALERLEQVSRGLKSKVSDDLRKRSAVQLRELVVICHRDLSPELFQSFYNAVNN
RITQLITHGSDSSERLGGIYALDALIDFEGVDVAVKYTRFTQNLKTILRGKDINPMQPAA
IALGKLCRPGGSMISEVVDSEVNTALEWLQNDRVEERRYSAVLVLRELARSAPTLMYQYI
PTIFDWIWIGLRDSRQLIRATSAETVSACFRILRERDQEMKQRWMSNIYNEAKQGLKVNT
VESIHGSLLVLKELLEQGAMYMQEHYQQACEIVFKHKDHRDPTIRKTVVLLIPDLASYSP
ADFAHTWLHKFMVYLSGMLKKDKERNDAFLAIGNIANSVKSAIAPYLDGVLIYVREGLSV
QSRKRGSVDPVFDCISRLAVAVGQTLSKYMEALLDPIFACDLTPKLTQALVDMAFYIPPV
KPTIQERLLDMLSVVLCGEPFKPLGAPHPNTLTSVPIIPKDAKDPLAYEHRRAEVKLALN
TLGSFDFSGHVLNEFVRDVAIKYVEDEDPEIREAAALTCCQLYVRDPIVNQTSYHALQVV
GDVIEKLLTVGVSDPEPNIRRTVLAALDERFDRHLAKAENIRILFFALNDEVFSIREVAI
SIIGRLARYNPAYVIPSLRKTLIQLLTELEFSDVARNKEESAKLLSLLVQNAQSLIKPYV
EPMISVLLPKAKDPNPSVAATILKAIGELATVGGEDMMPYKDRLMPLILDALQDQSSNAK
REAALHALGQLASNSGYVILPYIEYPQLLEILQSIIRTEGQRVPLRQETIKLMGILGALD
PYKHQAEERTPDSRNGEATQLTDISLMMTGLTPSNKEYFPTVVINALLQILKDSSLVQHH
AAVIEAIMNIFRTLGLECVSFLDRIIPAFLQVIRSATSTRLESYFNQLATLVSIVRQHIR
NYLPSIVEILQEYWHTSPSLQTTILSLVEAISRSLEGEFKIYLAGLLPLMLGVLDKDNSA
KRTPSERVMHAFLVFGASAEEYMHLIIPVIVRTFEKQGQPTFIRKQAIDTIGKISRQVNL
NDYAAKIIHPLTRVLDMGEPVLRTAALDTLCALIQQLGKDYLHFMGTVNKTINQHQIQHS
NYELLVSKLQKGEVLPQDLSSGAGFGDGADEATFADQGTKKLEMNAIHLKAAWDTKGKST
KEDWQEWLRRFSTTLLTESPNHALRACASLASVYLPLARELFNSAFVSCWSELYEQFQDE
LIQNIESAIKSENVPPDLLGLLLNLAEFMEHDDKALPIDIRVLGREAARCHAYAKALHYK
ELEFLQDQSSGAVEALIVINNQLQQSDAAIGILRKAQLYKEGIQLRETWFEKLERWEEAL
AFYNKREEEVPEDQAIPVDIVMGKMRCLHALGEWEALASLTGSTWANSTPEVQRMIAPLA
TAAAWGLNKWDSMDNYLSSLKRYSPDRSFFGAILALHRNQFREAIACVTQAREGLDTELS
ALVSESYNRAYQVVVRVQMLAELEELIVYKQCDEKKQAIMRRTWETRLKGCQRNVEVWQR
MLRLRAIVIAPTENMHMWIKFANLCRKSGRMGLAEKSLKQLIGTDAPLESMIPYWNDQRQ
PGPGPRSAPAAQVIYAVLKYQWETGQQAAKKTNIPEKTLYCLRKFTNDAAQRLDITRAHL
NAQVGSEVNITGDYGFQNPMDPTIMSPQTQRALYEQTVLLAKCYLRQGEWLIALNKDDWQ
YTQVQDILTSYSQATKYNPRWYKAWHAWALANFEIVQTLTAQNEGTLSRADQSMVIEHVV
PAVKGFFKSIALSEGSSLQDTLRLLTLWFTHGGSADVTSAVTEGFANVSVDTWLEVIPQL
IARINQPNKRVQQSVHNLLADVGRAHPQALVYPLTVAMKSWQNTRRSRSAAQIMDSMRQH
SANLVAQADIVSHELIRVAVLWHELWHEGLEEASRLYFGDHNIEGMFATLEPLHELLERG
PETLREISFAQAFGRDLKEAQDWCRQYETSQDVNDLNQAWDLYYQVFRRISRQLPQVTTL
ELTYCSPKLLNAKNLDLAVPGTYKSGQPIVRIMSFDTTFSVINSKQRPRKLNVNGSDGKS
YAFLLKGHEDIRQDERVMQLFGLCNTLLSHDSECFKRHLNIQRYPAIPLSQNSGLLGWVP
NSDTLHVLIREYRESRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDNTTGQDLYR
VLWLKSKSSEAWLERRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRVTGKIIHIDFGDC
FEVAMKREKYPERVPFRLTRMLTYAMEVSNIEGSFRITCENVMRVLRDNKESVMAVLEAF
IHDPLLTWRLTNAPSPAGPNFRNDRDTAMPVPGGVRARRQSILDSDVAPSELLNAPEPSI
QTRARARTNSSAGVPETNGGAPEVESQNARAVEVLDRVQQKLTGRDFKNNEELDVINQVN
KLIMEATKLENLCQHYIGWCSFW
NT seq 7272 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagcacagcagatcgccttggagcgactggagcaagtctcccgcggcctcaag
tcaaaggttagcgacgatttgcgaaagcgatccgccgttcagcttcgcgagctcgtagtt
atttgccatcgagaccttagccccgaattgttccagtccttctacaacgcagtcaacaac
aggattacacagctcatcacacatggaagcgactcttccgagcgactcggcggtatctac
gctctcgatgcgctcatcgacttcgaaggcgtcgatgtcgccgttaaatacacgcgtttc
acccagaatctaaagacgatcctccgtggaaaagacattaaccctatgcaaccagccgca
atcgcgcttggaaagttatgtcgacccggcggatcgatgatatcggaggtggtggattca
gaggtcaacacagcactcgaatggctacagaacgaccgcgtggaagagcgacgatatagt
gccgtcctcgtcctgcgtgaattggcccgcagcgccccaacgctcatgtatcaatacatc
ccgacaatttttgactggatctggattggtcttcgagactccagacagctcatccgggcg
acatctgcggaaacagttagcgcctgcttccgaatccttcgcgaacgagaccaagagatg
aagcagcggtggatgagcaatatttacaacgaagcgaagcagggtctcaaggtcaacacc
gttgaatccatccacggttcattactcgtcttgaaagagcttctcgagcagggcgccatg
tacatgcaggagcattaccaacaagcgtgtgagattgtctttaagcacaaggaccacaga
gacccgaccattcgaaagacagtggtcctcttgatccccgaccttgctagttattctccg
gccgatttcgcgcacacatggctacacaagtttatggtgtacctgtcgggcatgctcaag
aaggacaaggagagaaacgatgctttcctggcaatcggtaacattgccaattcggtcaag
agcgccattgctccttatcttgacggtgttttgatctacgtacgcgaaggtctcagcgtg
cagtcccgtaagaggggatcagtcgatccggtattcgactgtatcagtcgtctcgccgtg
gctgtaggccagacgctcagcaagtatatggaggcactgttggatcccatctttgcatgc
gaccttacccctaaactgacacaggcccttgttgatatggctttctacatccctccagtc
aaacccacaatccaagaacgattactcgatatgctcagtgtggtgctctgcggcgaaccc
ttcaagccgctcggtgcgcctcaccccaacactcttacctccgttccaattattcccaag
gacgccaaggatcctctcgcttatgagcatcgaagggccgaggtcaagctggcgctcaac
actcttggcagcttcgatttctccggacatgttttgaacgagttcgtccgggatgtcgca
atcaagtacgtcgaagatgaagacccagaaattcgggaggcggctgctttgacatgctgt
caactctacgtccgcgatcctattgtcaaccagaccagttatcatgcactccaggtagtc
ggggatgttatagaaaaacttctcactgtcggagtctcagatcctgaaccaaacataaga
agaacggtcctggcagctctcgacgaacgattcgatcgacacttggccaaggccgagaac
atccgcattcttttcttcgcgctcaacgatgaggtcttttccattagggaagtcgccatc
tctatcattggccgtttggctagatacaatccagcctatgttattccttcgctacgaaag
acgctcatccaactactcactgagctggaattctccgacgtggcccgcaacaaagaggag
agcgctaagctattgagtctcttggtccagaatgcgcagtctctcatcaagccatacgtc
gagcccatgatctcggttctcttacccaaagcgaaagaccccaacccgtcggtggctgcc
accatcctcaaggctatcggtgagctcgcgactgttggtggcgaggacatgatgccatac
aaagaccgattgatgcctctcattcttgatgcgctacaagaccaaagctccaatgcgaag
agagaggccgccttgcacgcacttggacagcttgcaagcaactccggatacgtcatttta
ccatatatcgagtaccctcaacttctagaaatcttgcagagcatcatcagaaccgaaggg
caacgagtgccattgcgacaagaaaccatcaaacttatgggtattctcggtgcgctggat
ccttacaaacaccaggccgaagaacgaactcctgattcacgaaatggcgaggccactcaa
ttgaccgacatctctctcatgatgaccggcctgacaccatcgaacaaggagtacttccct
accgtcgtcattaatgccctcctccaaatcttgaaggattcatccctcgtccagcaccac
gccgctgtgattgaagcaattatgaacatcttccgcactctgggcttggagtgtgtgtct
ttcctcgaccgaattatcccggcattccttcaagtcattcgatcggccacctccacaagg
ctcgaatcgtacttcaaccaactcgctactcttgtcagcattgtcagacaacacatccga
aactacctgccatcaattgtcgagatccttcaagaatactggcacacctctccatcgctg
cagactactattctgtcgctcgttgaggctatctccaggtcgcttgagggtgaattcaag
atttacctcgctggtctcttgccgttgatgcttggagtcttggacaaggataactctgct
aagcgcacgccatctgagagggttatgcacgctttcttagtgtttggtgccagcgcggag
gagtacatgcatctcatcatcccagttatagtccgcacattcgagaaacagggtcagcct
acatttattagaaagcaggccatcgacaccattggcaaaatctctcgacaagtcaacctt
aatgactacgccgcaaagatcatccaccctctcacacgtgtgttggacatgggtgagcct
gtgctacgaaccgcggctctggataccctctgtgctctcattcagcaattaggtaaggac
tacctgcacttcatgggcaccgtcaacaagaccatcaaccagcaccaaatccagcactcc
aactacgagctgcttgtgagcaagctccagaagggagaagttttgccacaggacctcagc
tcgggggctggttttggcgatggagccgacgaggctacctttgccgaccaaggcacgaag
aagctagagatgaatgccattcacctcaaggctgcctgggatacaaagggcaagtcgacc
aaggaggattggcaagagtggctacgacgcttcagtactactctacttacagaatcaccg
aaccacgcccttcgagcttgcgccagtcttgcgagcgtataccttcctcttgctcgcgag
ctgttcaattctgcgtttgtgtcttgttggagtgaactatatgagcagttccaagacgag
ctcatccagaatattgagagcgcaatcaagtccgagaacgttccaccggatctgttgggt
cttttgctcaacctcgctgagttcatggagcatgacgacaaggctttgccgatcgacatc
agagtcctgggtagggaggctgctcgttgtcacgcgtacgcaaaggctttgcactacaag
gaactcgagttcctgcaggatcagagcagtggtgctgtcgaggctttgatcgttatcaac
aatcagctccaacagtctgatgctgccattggtattcttcgcaaagctcaactgtataag
gaaggcattcagcttcgagagacctggttcgagaagttggagcgttgggaagaagcgctt
gcgttttacaacaagcgtgaggaggaagtgcccgaggatcaagcaattcccgtcgacatt
gttatgggaaagatgcgttgtttgcatgccttgggagagtgggaggcactggcttcgctg
actggcagcacctgggccaactctacaccagaagtccaaaggatgattgcacctttggca
acagctgccgcttggggtctcaacaagtgggattccatggacaactacctttcatcgctc
aagaggtactcacctgatcgttcattctttggtgccattctggctctccaccgaaaccag
ttccgcgaggccatagcgtgtgtcacgcaagctcgtgaaggtctggataccgagttgagt
gccctggttagtgagtcgtacaaccgagcataccaagtcgtcgttcgcgtccaaatgctt
gccgaattggaagaactcatcgtgtataagcaatgcgatgagaagaagcaggccattatg
agacgaacctgggaaacacgacttaagggttgtcaaaggaacgtcgaggtttggcagcgc
atgctcaggctacgtgctatagtgattgcaccaactgagaacatgcacatgtggatcaag
ttcgccaacctttgccgcaagtctggtcgaatgggtctcgccgaaaagtcactcaaacaa
cttatcggaacagacgctcctttggagtctatgattccctactggaacgatcagcgacaa
cccggacctggtcctagaagcgcgccggcagcacaggtcatctacgctgtgctcaagtac
caatgggagactggacaacaagctgccaagaagacaaacatccccgaaaagacactgtac
tgcttgcgcaagtttactaatgatgctgcgcagagattggatatcaccagggcccatctc
aatgctcaagtgggcagtgaagtcaacatcacgggcgactacggcttccagaaccctatg
gatcctacgattatgagccctcagacccagcgggcgttgtatgaacaaacggtcctgttg
gccaagtgctacttgagacagggagaatggctgattgcactcaacaaggacgactggcaa
tacactcaggtccaagacatcctcacctcttactctcaggcgaccaagtacaaccctcgt
tggtacaaggcttggcacgcttgggcactggcaaactttgagatcgtgcagactcttaca
gcccagaacgaaggaaccttatcgagggcggatcaatccatggtgattgaacacgtggta
ccagctgtcaagggcttcttcaagtcgatcgcgctgtctgaaggaagctcgctgcaggac
actcttcgtctgctcactctctggttcactcatggaggcagcgcggatgtcacttcagct
gtcacagaaggctttgctaatgtcagcgtcgacacgtggctggaggtcattccccagttg
attgcacgaatcaaccagcctaacaagcgcgttcagcaatcggtgcataacttgcttgcc
gatgttggacgagctcatcctcaagctttggtgtatcctctcaccgtcgccatgaagtcc
tggcagaacaccaggcgatctcgttccgcagctcaaattatggatagcatgcgacaacat
agcgcaaacttggtcgctcaggcagacattgtcagccacgaactcattcgcgtggccgtc
ttgtggcacgagctttggcatgagggactcgaagaagcctcgcgcttgtactttggcgat
cacaacattgaaggcatgtttgccactctggagcctctacacgagcttcttgagcgtgga
cccgagactcttcgtgagatttcgttcgcgcaagcatttggtcgcgaccttaaggaggct
caagactggtgcagacaatacgagacaagccaagacgtcaacgacctgaaccaggcatgg
gatttgtactaccaggtattccgcagaataagcaggcagttacctcaggttacaactctc
gagttgacgtactgttcacccaaattgctcaacgcaaagaacctcgacctcgctgtgccg
ggaacatacaagagcgggcagcctattgtccgtatcatgtctttcgacacgacgtttagc
gttatcaactctaagcagcgcccgcgaaagcttaatgtcaatggcagcgacggaaagtcg
tacgccttccttctcaagggtcacgaagatattcgtcaggatgaaagagtcatgcagctg
tttggtctctgcaataccctcctatcgcacgactcggaatgcttcaagcgtcacctcaac
atccagcgctacccagctattcctctgtcgcaaaacagtggtctgctcggatgggttccc
aacagtgacaccctccacgtccttatcagggagtaccgagagagtcgcaagattttgctg
aatatcgaacatcgaatcatgctccagatggctcccgattacgacaacctgaccctgatg
caaaaggtcgaggtctttggttacgccttggacaacaccaccggccaagatctctaccgt
gtattatggctcaagtcaaagtcgtccgaggcttggctcgagaggcgaacaaactacact
cgctcgctcggtgtcatgtccatggtcggctacattctcggattgggtgatcgtcacccg
tccaacttgatgcttgaccgtgtcaccggaaagattatccacatcgatttcggtgattgt
tttgaggttgcgatgaagcgtgaaaagtaccccgagcgggttcctttccgtctgacccga
atgttgacctatgccatggaggtcagcaacattgagggtagtttcagaatcacatgtgag
aacgtaatgagggtattgagagacaacaaggaaagcgtcatggctgttctcgaagcgttc
atccatgaccctctcctcacatggcgtctaacaaacgccccctccccagcaggccccaac
ttccgcaacgacagagacaccgccatgcccgtgcccggcggcgtccgcgcccgtcgccaa
tccatcctcgacagcgacgtcgccccctccgaactcctcaacgctcccgaaccatccatc
caaacacgcgcgcgcgcccgcacaaacagctccgccggcgtccccgagaccaacggcggc
gctccagaagtcgaaagccaaaacgcgcgagccgtcgaggttctcgatcgcgtgcagcag
aagctcacaggtcgtgattttaagaataacgaggagctggatgttattaaccaggttaat
aagttgatcatggaggcgacgaagctggagaatctgtgtcagcattatatcggatggtgt
agtttctggtag

DBGET integrated database retrieval system