KEGG   Fusarium graminearum: FG08395.1Help
Entry
FG08395.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fgr  Fusarium graminearum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FG08395.1
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    FG08395.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FG08395.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 924 aa AA seqDB search
MAHSDNSDLDPSWHDLDRAIGQILIMGWDGTEVTPQIRTLIEDHHLGSIILTAKNLKSEL
VQELQTIAKNAGHLQPLLIALDQENGGVNSLFDEDYVCQFPSAMGVAATGRADLAYEVTK
ATATEISACGVNLMLGPVLDVLNNARYQPLGVRATGDDPQEVSQYGLAALRGIRDAGIAS
CGKHFPSYGNLNFLGSNLDVPIITQTLEELSISALVPFRNAVASGKLDAMFVGGCGISNP
SMNVSHACLSEQVVDELLRDELGFNGVAISECLEMEALSHELGVQNGVIMAVEAGCDLVL
LCRAYDVQLEAIKGLKLGYDNGIVSKERIFTSLRRVLNLKSTCTSWEKALNPPGISLLSQ
LHPSHLALSLRAYDDSITIIRDKEKLIPLTASMHPGEELLLLTPLVKPLPASSLTKKLLA
AKDSQSQAEGPHEMWAHNDGRDRRAILSGEGVFREFGKSLARARNEKLLHTSYTANGVRP
VHENLIHRASCIVIVTADANRNLYQAGFTKHVDMMCSMLRARGQKKQLIVVAVSSPYDFA
MDKSIGTYICTFDFTENALHALARTLVGEITPLGTLPGTLRKSKKVVKSRQHWLVEEYSS
GRDASGLNDLLRAVHRASAPDLQFLRATTAASFQLNNPSIAESHFVVRNSSTNALYGFAA
TYYIHGVGIMGGVFVEPTKRDVSIGRSLHRRAIRSLLQRRGIKQVQIGSAFPGVFLGIPV
DVEVNTIKEWFANSGWDVQFPRRVSNMVIQDLANWSAPEGLSQSIQRAGISFDLIHGLDN
ADGVLSHVRNHASPEVLELYRHALSETKLSGIVRAKDASGNLLGTVIVCKQHSHLETYYP
SLKSRSEDISGILAPVVPSMPLATLTLQGLAFMGVRQARNHKATKVMLGSSVDDGTESLT
AMGFETLQAFEEITNSPENFSSLA
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggcccattcagataatagcgaccttgacccatcatggcacgatctcgaccgtgccatt
gggcagatcctcatcatgggctgggatggcactgaagtcactcctcagatcagaaccctc
atcgaggatcaccaccttggatccatcattcttactgccaaaaacttaaagtctgaacta
gtccaagagttgcagaccattgctaagaatgctggtcacttgcaacctcttctcatcgcc
cttgatcaggagaatggaggtgtcaacagtcttttcgatgaagattatgtttgtcagttc
cctagcgctatgggggttgcggctactggacgagccgacctagcgtatgaggtcactaaa
gctactgcaactgagatctcagcttgtggtgtcaacctcatgttgggtcctgtccttgac
gttctgaacaatgcccggtatcaaccactaggagtaagagccactggagacgacccgcaa
gaggtttctcagtatggccttgccgccctaagaggaatccgtgatgcgggaatagcctct
tgcgggaagcattttccttcttatggaaatctcaacttcctgggctcaaatttggatgtc
cctatcattactcaaacactcgaagagttgagcatcagtgctcttgttccattccgcaat
gctgttgcatcagggaaattggatgccatgttcgttggaggctgcggtatatccaaccca
tccatgaatgtcagtcatgcttgtctgtccgagcaagtcgtagacgagttgctacgagat
gagctcgggttcaacggtgtggcaatttcggaatgtctagagatggaggctctcagtcat
gagctcggtgtccaaaatggagttattatggctgtcgaggcaggttgtgatcttgtcctt
ctttgtcgcgcctacgatgtccagcttgaagctatcaagggtctcaagctgggctacgat
aatggtatcgtcagtaaggagagaatattcacgtcattgagaagggtactcaacctcaaa
tcgacgtgtacctcatgggaaaaggctttgaaccctccgggcatttctctcctttctcaa
ctccacccatctcaccttgcattatctctccgtgcctacgacgactcgataacaattatt
cgagacaaggagaaactcattccgctcacagcatcgatgcacccaggagaagagctcctg
ctgttgacccccttggtaaaacctctccctgcatcttctcttaccaagaagcttctcgct
gccaaggacagccaaagtcaagcagaaggcccacacgagatgtgggcgcataacgatggc
cgcgatcgtcgtgcaatccttagcggagaaggtgtcttccgagagtttggcaaatcactt
gctcgggctcgcaacgagaaacttcttcatactagctatacggccaatggtgtccgtcca
gtacacgagaatctaattcacagagcctcttgcatcgttattgttaccgccgatgccaat
cgaaacctttaccaggctggcttcacaaaacatgtcgacatgatgtgttccatgctgcgg
gccagaggacagaagaaacagctgattgtagttgccgtcagctctccatatgattttgcc
atggacaagtccatcggtacctacatctgtacatttgacttcacagagaacgccttgcat
gctcttgcgaggactcttgtgggagagatcacaccactcggtacgctccctgggacattg
cggaagagcaaaaaagtggtcaagtccagacaacactggctggttgaggagtacagctcc
gggcgtgatgcatcagggctgaacgaccttcttcgggctgtccaccgagcaagtgcacca
gatctacaattcttacgtgcaacaacggccgcctcgttccagctgaacaaccccagcatt
gccgagtcccactttgtcgtcagaaacagcagtacaaatgctttatacggattcgctgcc
acgtactatattcacggcgtcggcatcatgggcggtgtgtttgtcgagcccaccaagcgt
gatgtgtctatcggaaggtctcttcaccgacgagcaatcaggagtctcttgcaacgacga
ggtattaaacaagtgcagattggctctgcctttcctggagttttccttggtattcccgtt
gatgtcgaggtaaacactatcaaagaatggtttgcgaatagtggttgggatgtccagttt
ccccgccgtgtgtcgaacatggtcatccaagacctggcaaattggtctgctccagaagga
ttgtcgcaaagtatacaaagagctggtataagttttgatcttattcacggtctagacaac
gcggatggcgtgttgagtcatgttcgaaaccatgcaagcccagaggtgctagaattatac
cgtcatgcattgtcggaaacaaagctgagcggaattgtccgagcaaaagatgcttcgggt
aatctgttgggcacagtcatcgtttgcaagcagcacagtcacttggaaacatactatcca
tctctgaagtcccgctcggaggacatcagtggcattctcgctccggttgtaccatctatg
ccactggcaactcttactttacagggtctggcattcatgggcgtccgtcaagccaggaat
cacaaagcaacgaaagttatgctgggctcatccgtggacgatggcacggagtctctgaca
gctatgggtttcgagacacttcaagcgttcgaggaaattaccaactctccagagaatttt
tcaagtctagcatga

DBGET integrated database retrieval system