KEGG   Fusarium graminearum: FG08413.1Help
Entry
FG08413.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
fgr  Fusarium graminearum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 707 aa AA seqDB search
MTNVFAADTLLSQLGPPQSIADIAALSALGVASAAYLLRGITWDKPDHYHHVWFERMGSK
GGSSSSHPKATRDIAKKLEETGKDVVIFWGSQSGTAETFANRLSKECHLRFGLQALCADL
CDYDPESIANLSQSKLAIFILSTYGEGDPSDNTAAFWDWLTKTPNIQIPNLRYMAFGLGN
TSYRYYNRVIDVVAQHLDKYGAQRLMPVGRANDAQGGTEEDFLSWKDDLYTHFQENLGYQ
ERDIPYEPSIQLIQDESLDIMDLHLGEPIQNRNGPAKVVKQYSPIRPLAIQSSQELYTSP
GRNCLHMELDISNQPELRYRTGDHLAIYPINPDYEVQLLLKAFGLEDRAEKPLLVQTLEE
GTSTKIPSPTSALALFRHYLEVAAPVSRETVGQLARFAPLSESVETLTALAKNKEAYATY
IGSNHITMGRLLHLVAPGAIWTKLPLSYVVETLPCIQARYYSISSSSTVSARRLSITVGV
DKSPLQQDPSRVIRGITTNYLYALGNALNCDTSQSVVGSDAPSYALSGPGDTLNGRKVFA
CIRRSNFKLPTLSSTPIIMIGAGTGLAPFRGFILERARLQAVGKPIGKMLLFFGCRSPDQ
DYLYQGELAEVAQKLQGSLEIVTAFSRAEEEPKKYVQDRVEERKTQVCHLLQEGASIYFC
GRAAMARKVGNKVEESMKTQNNWTDAEARSWAESVKKGNKWLEDVWG
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgtctttgcagccgacactctcctctcccagctgggtcctccccaatcaatc
gctgatatcgctgctctgagcgccctcggcgttgcatcagctgcatatctcctccggggc
atcacctgggacaaaccagatcattaccatcatgtgtggtttgaacgtatgggctccaag
ggtggttcttcttcttcacaccccaaggcgactcgtgatatagccaagaaactagaagaa
actggtaaagatgttgtcatattctggggctcacaatctggcaccgcagaaacgttcgcc
aacaggctctcaaaagagtgccaccttcgcttcggtctccaggctctctgtgctgacctc
tgcgattatgatccagaatctatcgccaatctttctcagagcaagcttgcaatcttcatc
ctatccacatatggagaaggcgatcccagtgacaacacagccgccttctgggactggctc
accaagacacccaatatccaaatacccaacttgagatacatggcctttggtctcggtaac
acaagttatagatactataatcgtgttatcgacgttgtagctcagcatctcgacaaatac
ggtgctcagcggctcatgcctgttggtagagccaacgatgcccagggaggcaccgaagaa
gactttttatcttggaaagatgatctttatactcacttccaagagaaccttggttaccaa
gagcgcgatatcccatatgagccaagtattcagcttatacaagatgaatcgctcgatatc
atggatcttcatctcggggagcctatccaaaaccgaaacggacctgcaaaagttgtaaag
caatactcgcctattcgtcctctggctatccagtcatctcaagaactatacacctctcca
ggaagaaactgcctccacatggagcttgatatctcgaaccagcctgagcttcgatacaga
actggcgaccatcttgccatctatcccattaatcccgattacgaagtccagcttcttctc
aaggcttttggattagaagaccgagcagagaaacctctacttgttcaaactcttgaagag
ggtacatctaccaagattcctagtccgacgtcagctttggccctgttccgtcattatctt
gaagtagcagctcccgtgtctcgagagactgtcggacaattggcaagattcgcacctttg
tctgaaagtgttgagactttgacagctttggccaagaataaggaagcgtatgctacctac
attggcagcaatcacatcaccatgggccgtctgttgcatctcgttgctcccggagctatc
tggaccaagcttcctctctcttacgtggttgagacattgccttgcatccaagcacgttac
tactctatatcctcctctagcacagtctcggctcgcaggctttcgatcaccgtgggtgtc
gacaagtcaccgctacaacaagacccaagcagagttatccggggtatcacgacaaactac
ctctatgccctcggaaacgccctcaattgtgatacttcacagtcagttgtcggatctgac
gctccttcatatgctttgtccggtcctggagatactctcaacggccgcaaggtgtttgcg
tgtattcgtcgttcaaacttcaaactccccacgttgagttcaacacctatcatcatgatc
ggtgctggtacaggtctcgctccgttccgtggtttcattctcgagagagctcgtctccaa
gctgtcggaaagcctatcggaaagatgcttttatttttcggatgccggtctccagatcaa
gattatctctaccagggtgaactcgccgaagttgcccaaaagctacaaggcagtcttgaa
attgtgactgctttctcgcgagctgaagaggagcctaagaagtacgttcaagacagagtg
gaagagagaaagacccaagtgtgtcatcttttacaggaaggtgctagtatttacttttgt
ggtcgtgctgctatggcgaggaaggtagggaataaagtagaggaatcgatgaagacgcag
aataattggactgatgctgaggcccgaagctgggctgagtcggtgaagaagggaaacaag
tggcttgaagatgtttggggctaa

DBGET integrated database retrieval system