KEGG   Fusarium graminearum: FG08451.1Help
Entry
FG08451.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
fgr  Fusarium graminearum
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:fgr03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 392 aa AA seqDB search
MPEIAEVARIVHFLRLHVVGKRIISASATDDKNVFGKVGTSGEEVEAALKGKKIMSAGSQ
GKYFWIALEKPPHLVMHFGMTGWIHIKDEQTAYTNYYKKMKEGEHEQWPPRFWKFQFKTE
GSPEVEVAFTDSRRFGRVRLINCPGDEIRQHSPLVENGPDPVVDVDRFTEEYLHSKMRAR
HVPIKALLLDQTMISGIGNWVADETLYQAKLHPEQYCDQFSDAQITTLYKMIRYVCQTAV
DKLGDSDEFPEHWLFNYRWGKGSKDAATKLPNGEKIAFITVGGRTSCYAPGVQKKTGNTA
PGIKEESLESKAEAKPSKKSRKKSPDAEEGDASSPKKKRAKAVKKETNGDPVKKERAKTI
KKEINGDTIKKEPEVEEDKPDLGRRRSTRLRK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagattgcagaagttgcacgtattgtccacttcctacgactccatgttgtgggg
aaacgcatcatatccgcttcagcaacagatgacaagaatgtgttcggtaaagttggtacc
agcggcgaggaggtggaagcagccctgaagggaaagaagatcatgtctgctggaagtcag
gggaaatacttctggatagccctcgaaaagcctccccatctagtaatgcactttgggatg
acaggttggatacacatcaaggatgagcagacggcatacacaaactactacaagaagatg
aaggagggcgagcatgagcaatggccgccacggttctggaagtttcagttcaagactgag
ggctctcctgaagttgaagttgctttcacagattcgcgcaggtttggtcgtgtacgactc
atcaactgcccaggagatgagataagacaacactcaccccttgtcgagaacggcccagat
ccagttgtcgacgttgatcggttcaccgaggaatatttgcatagcaagatgcgagcccgt
cacgtacccataaaagcccttttactggatcaaacaatgatcagtggtattggaaactgg
gttgcagacgagacactctaccaggctaagctccaccctgaacagtactgcgaccagttc
agcgatgcgcaaatcaccactctctacaagatgatacgctacgtctgccaaacagctgtc
gacaagctaggagactctgatgagtttccggaacattggctcttcaattacagatggggc
aagggttccaaagatgctgcgacaaagctgcccaatggagaaaaaatagctttcatcaca
gtcggcggacgaacgagctgttatgctccaggtgtgcagaagaagactggcaatacagct
cccggaatcaaagaagaatctctcgaaagtaaggcagaagcaaagccctccaaaaagtca
aggaagaagtcaccagatgcggaagaaggagacgcttcatccccaaagaagaagcgtgca
aaggctgttaagaaggagaccaatggggatcccgtaaagaaagagcgtgcgaagactatc
aagaaggagatcaacggtgataccataaagaaggaacccgaggtagaggaagacaagcca
gacctaggacgaaggaggtcgacccgtctaaggaagtag

DBGET integrated database retrieval system