KEGG   Fusarium graminearum: FG08481.1Help
Entry
FG08481.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
fgr  Fusarium graminearum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1105 aa AA seqDB search
MEEDRQQGVMASDEDAEYETAGEAGGDTTIIATGSREDGGVSSVDRDPSDNGDIELSDRD
ASGEDVDASGEEDNEYTAPPQLSSHNSRQTDQEEQDGADEEAEEAEAGDAEEEHDDADVD
AEGDEDVDAEGEEYEDDEGVGAVKFQPGTRNHDDEDSESDKSDFPSANEEESDDEAAWDD
AAEAEEDHDDEETAAPSHCVFCNQSEDDDPSEEFETYLACTRCGNNAHQQCARDVAAMST
ENTPDHWKCPDCFGRESDAEGEDEEMEDHDVDDDAGLPSQQSEIPKLSGEAHFDQQMEDE
DASSHHESQHEDDNGLDEGLREPPRTLRKRKSSSLEGDGNVISLRKRRRNQFNDAASEGT
ARNGSAEPGRHNPSRTLRLKVTRPPPVSIKKHTRTSLVLKLQVKPGNLKEVLGRKKRETR
RQPGTVTRAPPQRPVPTPRATAIAAISVLPTPFTSDNYSQPLYFDCDLDEMQGKPYGGIL
SEAEADTSKTLPAEEDENRFKDALQKADEEWRARLLAMQEESNVPIRKAKKTADNASHIE
CIEFGGWEIDTWYAAPYPAEYCTTRVLYICEFCLKYMASDYVAWRHKLKCPAKHPPGDEI
YRHGSVSVFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYVLCEYNETGYHFVG
YFSKEKRASSQNNVSCILTLPIHQRKGYGNLLIDFSYLLTKVEEKTGSPEKPLSDMGLVS
YRNYWRLVMCRYFLTAMKEEKYATEGLSIKRISDNTGMTPDDVISALEGLRALVRDPQTK
TYAFRVDLDYCRQYVGKWEAKGYVQLKPEALVWTPYVMGRSNAVNFELGPPINTIAPRED
DEAKVDEGLGTAGTGGQTLINGEQNEEHAAGLNIDTGAETEANVNGEAQDDDVETDNAEP
APVQSIEDVAPGQEKDKDAEMKDAESDGPPTWLKPYQDIPYTRFEVFPAIPGGRRERARP
SVSRPAVPRTTSSAPRQKRSSGSHRTSSSRPKSSSKKKTGGTGRGPGRWPKGTKKSDYGN
ATSGPGLPPGWQDKQVKLRAITEGNDPDQEVAVEEPAEDSVVVSMRANGTKVNNRNAATR
KASVADANGEQAAEGEDVDAEGEDI
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggatcgtcaacaaggcgtcatggcttcagacgaggatgccgagtatgagact
gcaggcgaagcaggaggagacacaacaattattgcaacaggttcaagagaggacggggga
gtgtctagcgtcgatcgagacccctccgacaatggtgatatcgagttgagcgaccgcgat
gcttcaggcgaggatgtagacgcatcaggcgaggaggataatgaatacacggcaccccca
caattatcgtcccacaacagccgacaaaccgatcaagaagaacaagatggagcggacgag
gaagcagaagaagcagaagcaggggacgccgaagaggaacatgacgatgcggatgtggat
gctgaaggcgacgaagacgttgacgccgaaggagaagaatatgaagatgacgagggcgtt
ggcgccgtcaaattccagccagggaccaggaaccacgacgacgaagatagtgaaagcgat
aaatctgatttccctagcgccaacgaagaagagtcagatgacgaggctgcctgggacgat
gctgccgaagccgaggaagaccatgatgatgaagaaactgcagcaccgagccactgcgtt
ttctgcaatcaaagcgaagacgacgatccaagcgaggagttcgagacgtacttggcttgc
actcgttgtggcaataatgctcaccagcaatgcgcgcgcgatgtcgcggcaatgagcacc
gaaaatacccctgatcattggaaatgccccgattgttttggtcgagaatctgatgcggag
ggagaagatgaggaaatggaagatcacgatgtcgacgatgatgccggacttccctctcaa
caatccgaaattcccaaactctcaggcgaagcccatttcgatcaacaaatggaagatgaa
gatgccagctcccatcacgagtcacaacatgaagacgacaacgggcttgacgaaggtctg
agagagccaccgcgcacgttgaggaagcggaaatcgtcatccttggaaggtgatgggaac
gtgatctccctaagaaaacgccgaagaaaccagtttaatgacgcagcatctgaaggtacg
gcgcgaaatggaagcgctgaaccaggtcgacataacccttccagaactctacgtctcaag
gttacacggcccccacctgtttcaataaagaagcacacacgcacgtcgctcgtactcaaa
ctccaggtcaagcctggtaaccttaaggaagttcttggccgcaaaaaaagagaaactcga
cgacaacctgggactgtcacacgagcgcctccccagcgaccagtcccaacaccaagggct
accgccattgctgccatatctgtccttccaactccctttacatccgacaactattcacaa
ccattatactttgactgtgatttggacgagatgcagggcaaaccctacggcggtattctg
tcagaagcagaggctgacacatccaaaacgcttccagccgaagaagatgagaataggttc
aaggatgccttgcagaaggccgacgaagaatggagggcacgacttctggccatgcaagaa
gagtccaatgtgcctatccgaaaagcaaaaaaaactgccgacaatgccagtcatatcgag
tgcatcgaatttggcgggtgggaaattgatacgtggtatgccgcgccatatcccgccgag
tactgcacaactcgggtactgtacatttgcgagttctgtctcaaatacatggcgtcagac
tacgttgcgtggcgacacaaactcaagtgcccggccaaacatccaccgggcgacgagatc
tatcgacacggatctgtctcggttttcgaagtcgatggccggaagaatccggtctactgc
cagaacctgtgtcttctcgccaagctgtttttaggttcgaaaactctatactacgacgta
gaacccttcctcttctacgtgctgtgtgaatacaacgagacaggatatcactttgtggga
tacttctcaaaggaaaagcgagcaagtagtcaaaacaatgtctcttgtatcctcacactg
ccaatacatcaacggaaaggctatggcaacttgcttatcgatttttcatatctgctcaca
aaggttgaggagaaaactggctcgccagaaaagccgttatcggatatgggtctggtttca
taccgtaactactggcggctagttatgtgtcggtacttcttgacagcaatgaaagaggag
aagtatgcgacagaggggcttagcatcaagcgcatatccgacaataccggcatgacacca
gatgatgttatatccgccctagagggcctaagggctctcgtcagggatccacaaaccaag
acttatgccttcagagttgacttggactattgccgacaatatgtgggcaaatgggaggca
aaaggctacgtccagttgaagccagaagctcttgtttggacaccatatgttatgggacga
agcaacgctgtcaattttgagctaggccccccaataaacactatcgcaccaagggaagac
gacgaggccaaggtcgacgaaggactcggaacagctggcactggaggccagacattaata
aacggagagcagaatgaggaacatgctgcaggtctaaatattgacactggtgctgagacc
gaagcgaacgtcaacggcgaagctcaggatgatgacgtcgaaactgacaatgctgagcca
gccccggtccagtccatcgaggacgtggcgccagggcaagagaaagataaggatgccgag
atgaaggatgcagaatctgatggcccgcctacttggctaaagccatatcaggatattccg
tatactcgcttcgaagtattcccggctattcctggaggcaggcgtgagagggcaagacca
agtgtcagccgtccggccgtgcctcgtactaccagtagcgccccgaggcaaaagcggagt
agcggcagccatcgcacttcatcgtccagacccaagagctcatcaaagaaaaagactggt
ggcacaggtcgtgggccaggccgatggcctaagggtactaaaaagtctgactatggaaac
gcaaccagcggacctggtctgccacccgggtggcaggacaagcaagtcaagctgcgagcc
atcaccgaagggaacgacccagaccaagaagtggctgtcgaggagccagcagaagactcg
gtcgtggtgtcgatgcgggctaatggaacaaaagttaataacaggaatgctgctacacgc
aaggcctctgttgcagacgcgaacggagagcaagctgctgagggagaagacgttgatgcc
gaaggggaggacatttaa

DBGET integrated database retrieval system