KEGG   Fusarium graminearum: FG08544.1Help
Entry
FG08544.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
fgr  Fusarium graminearum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    FG08544.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     FG08544.1
Peptidases [BR:fgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   FG08544.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1057 aa AA seqDB search
MASLGHSRASSVATAGSHSLGSPGAFNHGSIPTSHRGGDSPSKASLPHIDDVIAPPQDLD
PNMSARKLLETAETALRQAEMSRDFRRPAIALKEYIRASIIAIQILTKHPDYHDLKANHA
DFRRAHMNLLNKISDQDPIYAKVKQDIIADNKRSGVQPRIVRSNLSQGGSRPQTPSGLTA
DGTMSPSKPRFNGAVTNGSPARSKPMIQPKPQSLHGNAIRTGVQKETRPVNQDLAARFAN
LRGPQASPGQDPRIKTHHIPLPKPMGPREMPPPRPPKVGIDTSVPTLPKMPDAIYSPARG
SISGEVTRPPSSTPRSLYRTASTASGPGTPNASSQSQPDYFAPTQSYSNNSIPPAPPSNL
TSPIKIPDGHTISPEELYQAMKAKGRILVIDIRMRDDFNDGHILSSSTICIEPSILLRDN
PSADDISESLILSPNQEQSLFEQRNLYDLVVFYDQDSKDFPRQPRNQDDMAIISLHHALV
HFNYMKELKNTPKMLEGGLDAWIDLMGQASLGSTTSAVSRSGQLDRNRNRQSGIERVRSK
YIVKPLKPDEVKVWQETLKHDDDMQTASSPNFTRTTEDFLRRFPPVSLEQESMVSPEEKP
QNRAVYGLSHKVDLYTDLPSPPTRPAPALPRRSYSGLTEGRDENELYGNNNTVVPARPSR
VPTMKSLEHQLTGDSNKFYTGLNNPHNWCYANSTLQSLLASPDFGKMLANSEWVTKYKAP
RKQDEKIDHPQLMIRIISNLFHWMNSGKFQIMKAQTLMDYSRHLCEQSRSIEQFGGSQQQ
DAQEFMSFILTHLHDETNTRRDRQGNIPQPDTSRQTLLKAAIQFWNNHLEYNQSIVDRFW
RGLELSTVECLECSTRTYMYTTFDLITVTVGMGRGMTLEQAFDEYASSSPIEDFACARCC
RPTHAQQSLSFARFPTLLCVAFRRFNYQPATRDTRKSTAPITWDFNDTDFTRYFLPRGAR
ESSSGTDPMDPSFTGPFRYEAYAVIIHTGSQINNGHYLAYVRDYTSHDPYAWYCCNDTRV
TKVRIGSGDRDDVQEEVFKSGRDKVPYLVFFRRKGMR
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctaggccattcacgggcaagcagcgtggctacagcaggatcgcactccttg
ggcagtccaggcgcattcaatcatggctcaataccgactagccatcgagggggtgactct
ccctcgaaggcttcacttccacatatagacgatgttattgctcctcctcaagacctcgac
cctaatatgtcggcccggaagcttctcgaaacggccgaaacggccttacgacaagccgag
atgtctcgagactttcgcagaccagccattgctctgaaggaatacatacgagcctccatc
atcgcaattcaaattctcaccaaacaccccgactatcatgatctcaaagccaaccatgcg
gatttcagacgggctcatatgaacctgcttaacaagattagcgaccaggatcccatatat
gctaaagtcaagcaagacatcatcgcagacaataaacgatcaggcgtacagccacggata
gtccggtcgaacttatcgcagggggggagtcggccccaaactccgtcagggttgacagcg
gatggaaccatgtcgccgtcaaaacctcgctttaacggggctgtcactaacggttctcct
gctcgatcaaagccgatgattcaaccaaaacctcagtctctgcatgggaacgctattaga
acgggggttcaaaaggaaaccaggccagtaaatcaagatcttgctgccagattcgccaac
ctaagaggcccgcaagcatcgcccgggcaagatcctcgtatcaagacacaccacatacca
cttccaaaaccaatgggtcctcgagagatgcctcctcctcgaccaccgaaggttggcatt
gacacaagtgtgccaactctacccaaaatgcccgatgcaatctacagtcctgcccgtggt
agcatttcaggagaagtaacaaggccgccctcaagtacaccacgcagcttgtatcgtaca
gcctcgacagcttcgggccctgggacacctaacgcctcatcgcagtcgcagcctgactat
ttcgccccaacgcaaagctattccaacaactctatccctcccgcccctccgagtaatctt
accagccccatcaagattcctgatggacataccatttcccctgaagagttgtaccaggcc
atgaaagccaaaggcagaattctggtaatagatattcgaatgcgtgatgatttcaacgat
ggacatatcttgtcgtcgtcaacaatatgcattgagcctagcattttgctcagagacaac
ccctccgcagacgatatttccgaaagcttgatcttgtcacccaaccaggagcagtctctt
tttgagcagcgtaatctttacgatctagtagttttctatgatcaagactctaaagatttt
cctcgacaaccacgaaatcaggatgatatggcaatcatctctctccaccacgccctagtt
catttcaactatatgaaagaactcaagaacacgccaaagatgcttgaaggaggtctagat
gcatggattgacctaatgggacaggcgtcactaggatcgaccacttcagccgtgagcaga
tcagggcaactggaccgaaaccgaaaccgacaatcaggcatcgagcgggtgaggtccaag
tatatcgtcaagcctctcaaaccagacgaagtcaaagtctggcaagaaacactcaagcat
gatgatgatatgcaaacagcatcgtcgccgaattttacacgtactacagaagactttctg
agaagattcccaccagtgtccctggaacaagagtcgatggtttctccagaggaaaagccg
caaaaccgagcagtctacggcttatctcacaaggtagatctatatacagacttgccctcg
ccgcccacaagaccagcgcctgctcttccacgccgtagctacagtggcctcactgagggg
cgtgatgaaaatgagctttacggaaacaacaacacggttgtacccgcacgaccatcaaga
gtgccgaccatgaaatccttggagcaccagttgacgggtgattcaaacaaattctacact
gggcttaacaaccctcataactggtgctacgcaaacagcacacttcagagccttcttgct
tcgcccgatttcggtaagatgctggcgaattcggaatgggtcaccaaatacaaggctccg
aggaaacaagatgaaaagatcgaccatccccaactcatgattcgtatcatctcgaacctg
ttccactggatgaactcgggcaagtttcaaattatgaaggctcaaacactcatggactac
tcgcggcatctttgcgaacagagtcggagtattgagcagttcggcggatctcagcaacaa
gacgctcaggagtttatgagtttcattctgacacacctccacgacgagaccaacacacgg
cgagaccgacagggcaacatcccacaaccggacacttctcgtcaaacactgttaaaagcc
gctatacagttctggaacaaccacctcgaatataaccaatctatcgttgaccgcttctgg
cgtggtcttgaattatcaactgtcgagtgcctcgaatgtagcacacgtacctacatgtat
accaccttcgatcttatcaccgttacggtgggcatgggccgtggtatgactcttgagcag
gcttttgacgagtacgcctcgagcagccctattgaagattttgcttgcgcccgttgctgc
cgcccaactcacgctcaacagagtctctcatttgctcgctttcccaccctactctgcgtc
gcgtttcgccgcttcaactaccaaccggctacaagagacacccgcaagtctactgcgcct
atcacatgggacttcaacgacaccgacttcactcgctacttcctccctcgaggtgctcgc
gagtcttcgtccggtaccgatcccatggacccttcctttacagggcccttccgctacgag
gcttacgcagtcattattcacaccggcagtcaaattaataacgggcattacctggcgtat
gtgcgcgactatacgtctcacgacccctatgcttggtactgctgtaacgatacccgtgtg
acaaaggttcgcattgggagtggagatcgcgatgatgttcaggaagaggttttcaagtcg
ggtcgagataaagtcccgtacttagtcttcttccgccgcaagggcatgcgttga

DBGET integrated database retrieval system