KEGG   Fusarium graminearum: FG08691.1Help
Entry
FG08691.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
fgr  Fusarium graminearum
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:fgr04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 647 aa AA seqDB search
MSASDSVPATPEDWKDLSTPGSPGSEDSSEPTTPLESPSHDSPSEPPRRVPSLRSVSDPR
NMNPNSTPIGVLGIARRPVQPSFSFAGNSSASVENSAMAKARALHQQRLQKGNSASPVGQ
SPTSSISNGFPVNLRMPPNMQRPQPPHANSAPVVSKPSLSERRAKMGMGMKLSDMGGSSP
AATTGKRGPPGKLSDITGDAPSNKESNGTGGGHGSKMDDFKKYIDTEKGWVTFDGAATIT
RTGVNFANGQTFSISLDEVEVLTELGKGNYGTVYKVKHAKRSLPRFGQGLSRKPPAVQYT
QSDPSPVRPVEDSAGGQSNSGDGTTGTVMAMKEMRLELDDAKFTTILKELVILHECVSPY
IIEFYGAFFQEGAVYMCIEYMDGGSIDKLYAGGIPENVLRKITYSTVMGLKSLKDEHSII
HRDVKPTNILVNTRGQVKICDFGVSGNLVASIARTNIGCQSYMAPERISGGGYAQAGNSD
GSYSVQSDVWSLGLTVIECAKGAYPYPPEVSSTIFSQLSAIVEGEPPAMPEEGYSDTATD
FVRSCLHKIPKQRPTYAMLLKHPWLIDFTKPQTITEEAEDGDEADKVAEAVGKIALNSTT
EDAEVADWVNGVLQKERDGLKVGGPLRPALHTAPLDSVSPISSPNDA
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctccgactcggttccggccacgccggaggactggaaagacctttcgacgcct
ggatctcctggctctgaagattcgtctgaacctaccacgccactcgagtctccaagccat
gatagtcccagcgagccccctcgaagagtcccatccctacggtccgtttctgaccctcgc
aatatgaatccgaactctactccgataggagttttaggcatagccagacgtcccgtgcaa
ccatccttcagttttgctggaaacagtagtgcctcggtggaaaatagtgctatggccaag
gcacgagcattgcaccagcaacgcctgcaaaagggcaattcagcatcgcctgtagggcag
tcaccgacgtctagcatctcgaacggattccccgtcaatctgcgaatgcccccgaacatg
caaagaccacagcctccgcacgccaactcagctcctgtggtatcaaagccttcgttaagt
gagagaagggccaagatgggcatgggcatgaagttgtccgatatgggcggatccagccct
gccgcaaccacgggtaagcgtggaccccctggaaaactatcggacatcacaggcgatgca
ccaagtaataaagaatcgaacgggacaggaggcggccacgggtcgaaaatggacgacttc
aagaaatatattgatacggagaagggatgggtcacatttgatggggctgcaaccatcaca
cggacgggagtcaacttcgccaacggccagaccttcagcatatccctcgatgaagtggaa
gtattgactgagctgggcaagggaaactacggaacagtctacaaagtcaagcatgccaag
aggagtcttccacggtttggacaaggcttgtcaagaaagccgcccgctgtccagtataca
caatcagacccttcaccagtcaggccggtcgaggactcggctggtggccaatcaaactcg
ggtgatggcactacaggcacggttatggcaatgaaagaaatgcggctggaactcgatgat
gccaagttcacaaccatcttgaaggagcttgtcatattacacgagtgtgtttcgccctac
atcattgaattttatggcgctttcttccaggagggtgctgtctacatgtgcatcgagtat
atggatggaggttccattgataagctatatgctggaggaattcccgaaaacgtgttgcga
aagatcacctattccacagtgatgggtttgaaatcgctgaaggatgagcacagtattatt
caccgagatgtcaagccaacaaacattctagtcaacacacgaggccaagtcaaaatctgc
gattttggcgtcagtggcaaccttgtcgccagtatagcccgaaccaacatcggctgtcag
agttacatggcacccgaaagaatttcaggtggtgggtacgcacaagcagggaactctgac
ggatcctacagtgttcagagtgacgtctggagtctgggtttaacggttattgagtgtgcc
aaaggtgcatatccttacccgccagaggtgtcctctactattttcagtcaactcagtgct
attgtcgagggcgaaccacccgctatgccagaggagggttactcggatacagccacggat
tttgttaggagctgccttcacaagatccccaagcagcggccaacctacgcaatgctgttg
aagcatccctggctcatcgatttcacaaaaccacagaccatcacagaagaggctgaggat
ggtgatgaggctgacaaggtcgcggaagctgtcggcaaaatcgctctcaactcaacaacg
gaggacgcagaagtggccgactgggtaaatggcgttttgcagaaggagagagacggtctg
aaggtgggcggtcccctaaggccagcattacacaccgcaccactcgacagcgtcagccct
atctcaagcccaaatgacgcctag

DBGET integrated database retrieval system