KEGG   Fusarium graminearum: FG08704.1Help
Entry
FG08704.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
fgr  Fusarium graminearum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1330 aa AA seqDB search
MALRSDINGTSTPTAESNGVASAARPRPNGRSTSNDTTGNDENDQRPLSAPGRRNGSIAL
ETRDDIEHQQQTRPAKPLLLRSKSDYAPRPMDEPEPIEEDIPDWGARHGFEDHYQSEDII
SQLANNWYMYYTDKRHETTGKPKPPQYELQDWRQRDRLKTVSAALAVCLNIGVEPPDQLK
TNPGAKLEAWTDPTVPPIQKALENIGKALQAQYETLAIRARYKQYLDPSVEETKKFCISL
RRNAKEERVLLHYNGHGVPKPTASGEIWVFNKNYTQYIPVSLYDLQHWLQAPTIFVWDCS
EAGNILNNYHRFVEKHEEEEDEAAERDPNYTKTNFRPYIHLAACAVKENLPTNPLLPADL
FTACLTTPIEMALWFFVLQNPLKTKVSPERAKKLPGRLQERRTPLGELNWIFTAITDSIA
WTTLPRDLFRKFFRQDLMVAALFRNFLLAQRVMTVYGCHPQSYPKLPDTHQHPLWETWDL
AVDMALSQLPALEKKESEGYDYEYQNSSFFTEQLTAFDVYLTRGDAMAQKSPDQLPVVLQ
VLLSQQHRVRALILLGRFLDLGPWSVQLALSIGIFPYVLKLLQSAAAELKPVMVFIWARL
IAVDLSCQQDLIKDSGYSYFAQILKPSEGLPVVDSDEHKAMCAFILAMLCKDYKNGQMVC
NQTDIMTYCLTHLQNEENPLLRQWACLCISQLWQDLPEAKWRGIRENAYVKLAYLVRDPC
FAAYEQLVEEKEYLIFPPQDDGQEHKMGLHYARPENRNKDGTIKPMAHGLSHNTVYMALW
KLALVLSVDPHPEVQREATIVVDYVHHALLSSKVGAQTQLVMAEIQKRATRMANRHMPNT
SQRNNTIGSSISQPLPSPGLLRRTASLLFPSLVINEDKSRPTTPTLPRSPSMKLVPNQVP
VPPEQNDRTSAQALYNVAHEPYSGAFKERDLTKPPTLPLKSRFLEWSIEYFREPQMKPSE
ADEPGSTEYNERLWRRARNETIFRETQPLKQQAGSHKWNNQLGIVNNGAQPAKMTFHQFE
DHLAVADEGNTVYVWDWKKQGRLSRFSNGNPEGSKISDMKFINEDDQAMLLTGSSDGVIR
VYRNYESDRAIELASSWRALTHMVPSNVNSGMVFDWQQVTGRVLVAGDVRVIRVWYAAYE
TCVMDIPARSGSCVTSLTSDQMTGNMFVAGFGDGAVRVFDTRNRPQESMVRKWKDESDRQ
WVKSVHMQRGGQRELVSASRNGKVKIWDIRMDKPLHSFQTTRDTLRTASTHEHLPVFAVG
TSAHTVKVFNLDGHELSSVEPYSSFLQQNRSSAISATAFHPHRPILGCAARGDHHINLFT
CEKSESMSSN
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgatccgatatcaatggtacctctacgcccactgctgagtcaaatggagtc
gcctcggcagcgagacccagaccgaacggccgctcaacctccaacgatactactggaaac
gacgaaaacgaccaacggcccttgagcgcaccaggccgtcgaaacggaagcatagccctg
gaaacgagagacgatatcgagcaccagcagcagacgcggcctgcgaagccgttactactc
cgatcgaagagcgactacgcgccacggccgatggatgagcctgagcctatagaagaagac
atacctgattggggtgctagacacggtttcgaagaccattatcaatccgaagatattata
tctcaactggctaacaattggtacatgtactataccgataaacgacatgaaacgacaggc
aaaccaaaaccaccccagtacgagctccaagattggcgacagagggacaggttaaaaaca
gtatctgcagctcttgcagtatgcttgaacataggagttgaacctcccgaccaactgaaa
accaacccaggagcgaaactcgaggcatggacagatccgaccgttcccccaattcaaaaa
gccctcgaaaacattggcaaggctctacaggcacaatatgaaactctcgcgataagagcg
cgatataaacagtacctggatccttctgtcgaagagacgaagaaattctgcatctcacta
cgtagaaatgccaaagaggaacgtgttcttctccattacaacggacatggtgttcccaaa
cccacagcatcaggcgaaatatgggtttttaataagaattatacccagtatatcccagta
tctttgtacgacctacaacattggctgcaagctcctactatttttgtttgggattgttct
gaagctggcaatatcctgaacaattatcacagatttgtcgagaagcacgaagaggaagag
gatgaagctgcagagcgggaccccaactacacaaagacgaatttccggccctatattcac
ctggctgcatgtgctgtgaaggagaatcttccaacaaaccctctgctgcctgccgatctc
tttactgcctgtctcactactcctatcgagatggctctttggttctttgttctacaaaac
cctctcaaaacaaaagtcagtccagagcgagcgaaaaagctgcctggccgacttcaagaa
cggcgaactccacttggtgagcttaattggatattcaccgccatcacagatagcatcgcg
tggacaacgttgccgcgtgatctatttcgcaagtttttccgacaggatctcatggtggca
gctctcttccgcaatttcctgctggcccagcgtgttatgactgtctatggctgccaccct
cagtcttatcccaagctgccagatactcatcaacatccattgtgggagacctgggacttg
gctgtagatatggcgctatctcagctccccgcgctggagaagaaggagagcgaaggctat
gactacgagtatcagaactcgagcttcttcacggaacaacttaccgctttcgatgtctat
cttacaagaggcgatgcaatggctcaaaagtcgcccgatcagttgcctgtcgtgttacag
gttctactcagccaacagcatcgtgttcgggctcttatcttacttgggcgtttccttgac
ttgggcccatggtctgttcagctcgctctgagtataggtatcttcccatacgttctcaaa
cttttgcagtctgctgcagctgaactgaagcccgtcatggtttttatctgggcacgtctc
attgctgtggacctttcttgtcagcaggatctcattaaagacagcggttacagttacttt
gcacaaatcctcaagccttctgaggggttgcctgtcgttgatagcgatgagcacaaagct
atgtgcgcgttcattctggcaatgctttgcaaagactacaagaatggccagatggtttgt
aatcagacagacattatgacttactgcttgacccatcttcaaaatgaagagaaccccctc
ctccgacaatgggcttgtctttgcataagccagttatggcaagacctcccagaggcgaaa
tggcgaggtatcagggagaacgcgtacgtcaagctggcttatctcgtgagagacccttgt
tttgcagcttacgaacagctagttgaggagaaggagtatctcatcttccctccccaagat
gatggccaggaacacaaaatgggcttgcattacgcaaggccagaaaaccgcaacaaggac
ggcaccatcaaaccaatggcccatggtctttctcataacaccgtatacatggccttatgg
aagttggctctagtactcagtgtggatcctcaccctgaggtacaacgagaagctactatt
gtggtagactatgttcaccacgcgcttctcagctcaaaggtcggagctcagacgcaactt
gtcatggccgagattcaaaagcgtgcgacaagaatggcaaataggcacatgcccaacaca
agccaacggaacaatactattggttcttcgatctcgcagccattaccttcaccgggactc
ttgcgccgaacagccagtttgctctttccctcattagtcatcaatgaagacaaatcgaga
ccaacaacaccgaccctgcctcgatcaccgtcgatgaaactcgttccgaatcaagtgccc
gtgcctcctgaacagaacgaccgcacctcagcgcaggcgttgtacaatgttgcgcatgaa
ccgtattcaggtgcattcaaagagcgagatttgacaaagccccccacgctcccactcaag
agcagattcctggaatggtccattgagtacttccgtgaaccacagatgaaaccaagcgaa
gcagacgagccgggaagcaccgagtacaatgaacggctttggcgaagagctcgaaatgaa
accattttccgagaaactcagccattaaagcaacaagcgggaagccacaagtggaacaat
cagcttggaattgttaataatggggctcagcctgcaaagatgaccttccatcaatttgag
gaccatcttgctgttgcagatgagggcaacacagtttacgtgtgggattggaagaagcag
ggtcgattaagccgtttcagcaacggaaatccagaaggttccaagatcagcgatatgaaa
tttatcaatgaggatgaccaagcgatgttgcttacagggtcttccgatggtgtgatcaga
gtatatcgcaactacgaatcggacagagccatcgagcttgcttcttcttggcgcgccttg
acacacatggtacccagtaacgtcaactcaggaatggtgttcgattggcagcaggtcaca
ggccgggtcctcgttgctggcgatgttcgagttattcgggtatggtatgcggcttatgag
acctgtgtcatggatattccagcgcgctcgggatcctgcgttacttccctaacttctgat
caaatgactggcaacatgtttgttgccggctttggagacggtgctgttcgcgtcttcgat
acaaggaacagacctcaagagtcaatggtgcgcaagtggaaggatgaatcggatcggcaa
tgggtcaagagcgttcatatgcagcgtggtggtcaacgggagcttgtgagcgcaagcagg
aacggtaaggtgaaaatctgggatatccgtatggacaagcccctgcattcgttccaaaca
acacgagacacgcttcggactgccagcacacatgaacacctaccggtctttgcagtgggc
acatcggctcacaccgtcaaagtattcaaccttgatggtcatgagctctcgagcgttgag
ccttactcgagcttcttgcaacagaatcgcagctcggctatctcagcaaccgcattccac
cctcatcggccaatcctaggatgcgctgctcgaggtgaccaccacatcaatcttttcaca
tgcgagaaatccgaatctatgtcctcaaattag

DBGET integrated database retrieval system