KEGG   Fusarium graminearum: FG08729.1Help
Entry
FG08729.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
fgr  Fusarium graminearum
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:fgr04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 392 aa AA seqDB search
MAATVAPSHAAGLPSSSGIPASSHSVNSHSHSQDVSGASTSSAPSPLPQTRKFNLRDFRR
VRTLGTGTFARVCLVRPAATAHIPLDHQLNPEVYALKILRKPEVIRLKQVDHVRHERAIL
ADVAGHPFITTLIASFSDQDSLYMLLDYVPGGELFTYLRKLRRFEEPVARFYAAEIVLVL
EYLHEQQGGIAYRDLKPENLLLDQDGHIKLVDFGFAKRLGYREDNRPAETYTLCGTPEYL
APEVIQNKGHTGAVDWWALGILIYEFLTGYPPFWHQNPIEIYKQILEKPVVFPQDPSLSE
EAKDIIRSLCTVDRSRRLGNISGGAARVKSHPFFQDTDWDEILDRRHKGPIQPPIRYPGD
AQCFDVYPEDDGTREPYGREMAEKYDPYFADF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggccgctaccgttgcgccttcacatgccgctggcctgccgtcgtcatcaggcatccct
gcgtcgtcacattccgtaaactcacattcgcactctcaagatgtctcgggcgcatcgaca
tcctccgccccaagcccgttaccacaaacccgcaagttcaatctccgagactttagacgg
gttagaacgctagggacaggaacatttgcccgagtctgcctcgtccgtcccgccgcgacc
gcgcatatccccctcgatcaccaactcaaccccgaagtttatgctctcaaaatactccgg
aagccagaagtcattcgtcttaagcaggttgaccatgtccgacacgaacgcgccatcctc
gccgatgtggcaggtcacccttttatcacaactctgatcgcctctttttctgatcaggat
tcactctacatgctactcgactacgttccgggcggagagctgttcacataccttaggaag
ttacgccgattcgaggaacccgtcgctcggttttacgctgcggaaattgttctggtcctg
gagtacttacacgagcagcaaggcggcatcgcttaccgagacctcaagcctgagaacttg
cttctggaccaggacggccacattaaactagttgatttcggcttcgcaaaacgactcggc
taccgcgaagataaccgcccagctgagacatacaccctatgtggaacacctgagtacctt
gctccagaagtgattcaaaacaaaggacacaccggcgcagtcgactggtgggcattgggc
attttgatatacgaattcttgacggggtacccgccattctggcaccagaatcctatcgaa
atctacaaacaaattctagagaagcctgtcgtctttccacaagacccctcattgtcagaa
gaagccaaagatataatacgctccctctgtaccgtcgatcgttcgcggcgcctcggcaac
atcagtggtggtgcagcccgtgtcaagtctcaccccttctttcaagacacagactgggat
gaaatcttggatcgccgacataaaggccccatccagcccccaatacgatacccaggtgat
gcgcaatgttttgatgtgtaccccgaggacgacgggacccgcgagccatacggtcgtgag
atggcggagaagtatgacccatactttgctgatttctga

DBGET integrated database retrieval system