KEGG   Fusarium graminearum: FG08729.1Help
Entry
FG08729.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
fgr  Fusarium graminearum
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    FG08729.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     FG08729.1
Protein kinases [BR:fgr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   FG08729.1
Messenger RNA biogenesis [BR:fgr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     FG08729.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 392 aa AA seqDB search
MAATVAPSHAAGLPSSSGIPASSHSVNSHSHSQDVSGASTSSAPSPLPQTRKFNLRDFRR
VRTLGTGTFARVCLVRPAATAHIPLDHQLNPEVYALKILRKPEVIRLKQVDHVRHERAIL
ADVAGHPFITTLIASFSDQDSLYMLLDYVPGGELFTYLRKLRRFEEPVARFYAAEIVLVL
EYLHEQQGGIAYRDLKPENLLLDQDGHIKLVDFGFAKRLGYREDNRPAETYTLCGTPEYL
APEVIQNKGHTGAVDWWALGILIYEFLTGYPPFWHQNPIEIYKQILEKPVVFPQDPSLSE
EAKDIIRSLCTVDRSRRLGNISGGAARVKSHPFFQDTDWDEILDRRHKGPIQPPIRYPGD
AQCFDVYPEDDGTREPYGREMAEKYDPYFADF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggccgctaccgttgcgccttcacatgccgctggcctgccgtcgtcatcaggcatccct
gcgtcgtcacattccgtaaactcacattcgcactctcaagatgtctcgggcgcatcgaca
tcctccgccccaagcccgttaccacaaacccgcaagttcaatctccgagactttagacgg
gttagaacgctagggacaggaacatttgcccgagtctgcctcgtccgtcccgccgcgacc
gcgcatatccccctcgatcaccaactcaaccccgaagtttatgctctcaaaatactccgg
aagccagaagtcattcgtcttaagcaggttgaccatgtccgacacgaacgcgccatcctc
gccgatgtggcaggtcacccttttatcacaactctgatcgcctctttttctgatcaggat
tcactctacatgctactcgactacgttccgggcggagagctgttcacataccttaggaag
ttacgccgattcgaggaacccgtcgctcggttttacgctgcggaaattgttctggtcctg
gagtacttacacgagcagcaaggcggcatcgcttaccgagacctcaagcctgagaacttg
cttctggaccaggacggccacattaaactagttgatttcggcttcgcaaaacgactcggc
taccgcgaagataaccgcccagctgagacatacaccctatgtggaacacctgagtacctt
gctccagaagtgattcaaaacaaaggacacaccggcgcagtcgactggtgggcattgggc
attttgatatacgaattcttgacggggtacccgccattctggcaccagaatcctatcgaa
atctacaaacaaattctagagaagcctgtcgtctttccacaagacccctcattgtcagaa
gaagccaaagatataatacgctccctctgtaccgtcgatcgttcgcggcgcctcggcaac
atcagtggtggtgcagcccgtgtcaagtctcaccccttctttcaagacacagactgggat
gaaatcttggatcgccgacataaaggccccatccagcccccaatacgatacccaggtgat
gcgcaatgttttgatgtgtaccccgaggacgacgggacccgcgagccatacggtcgtgag
atggcggagaagtatgacccatactttgctgatttctga

DBGET integrated database retrieval system